Clone FI07238 Report

Search the DGRC for FI07238

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:72
Well:38
Vector:pFlc-1
Associated Gene/TranscriptCG34331-RB
Protein status:FI07238.pep: gold
Sequenced Size:622

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34331 2008-08-15 Release 5.9 accounting
CG34331 2008-12-18 5.12 accounting

Clone Sequence Records

FI07238.complete Sequence

622 bp assembled on 2008-07-29

GenBank Submission: BT050508.1

> FI07238.complete
CCAGAGTTGCTTCTTGCTTGCCACCGAGATGAGCGCAATAAAGCCCGCCC
TGCTGCTCTGCCTGATCCTCACCATCGGTCTGTTCCTTGGTCAAGGTCGG
GCGAATCCCGTGGAGACGAATGTTCCCGATATTCCCGCACCCGATGCCAA
CGAACTGGGCATCGATTTCGGAGAGGAGGAAGATGCCACCGACAAGCCAC
TGGGCATATTCACGATCAAGGTGCGCCACATTCAGCCGGACCCCGCCCAC
TGCGCCCAGCTCTCGCCACATCACCCACACCACCCCCAGTGCCACAGCTA
CTGCAAACGCCAAGGTCACTGGGTGGGCCAGTGCAAGAAGGACATCTGTC
AGTGCTTTTCCTAGGTCTACTTCGACTGTAAGCCAAAACAGCGTTTTTTT
TTTTCTTTTGTTGAGTGCAGCACAACTATATGACGAAATATGTGCAAATA
TGTTTATCTACCAACTAGTATATATATTAAAACTGGCAATGAACAATGAA
AGCGAATCAAAATTGCTCAAATCATACACATAATATGTAGTCTTTGACCT
TCTAACATGCACTGAATAGAAAAAGCAGAACCTTAATAAATCTTCAAGTT
AAATCCAAAAAAAAAAAAAAAA

FI07238.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34331-RB 605 CG34331-RB 4..603 5..604 3000 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20011034..20011633 5..604 2955 99.5 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG34331-RB 336 CG34331-PB 1..336 29..364 1680 100 Plus
CG34331-RC 405 CG34331-PC 1..192 29..220 960 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:17 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:59:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG34331-RB 609 CG34331-RB 8..607 5..604 3000 100 Plus
CG34331-RC 599 CG34331-RC 8..223 5..220 1080 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG34331-PB 111 CG34331-PB 1..111 29..361 482 100 Plus
CG34331-PC 134 CG34331-PC 1..69 29..235 250 95.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20122460..20123063 5..608 3005 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20130558..20131161 5..608 3005 99.8 Plus
Blast to na_te.dros performed on 2014-11-27 08:59:05 has no hits.

FI07238.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:18:52 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20011029..20011635 1..606 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:55:21 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RA 50..414 1..364 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:33 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 1..336 29..364 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:04:30 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 1..336 29..364 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:55 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RA 50..414 1..364 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:18:52 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 1..336 29..364 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:34:34 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RA 50..656 1..606 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:33 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 1..605 3..606 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:04:30 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 3..609 1..606 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 13:44:34 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RA 50..656 1..606 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:18:52 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 3..609 1..606 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:18:52 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
X 20122455..20123061 1..606 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:04:30 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20016488..20017094 1..606 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:38:06 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
X 20130553..20131159 1..606 99   Plus

FI07238.pep Sequence

Translation from 1 to 363

> FI07238.pep
QSCFLLATEMSAIKPALLLCLILTIGLFLGQGRANPVETNVPDIPAPDAN
ELGIDFGEEEDATDKPLGIFTIKVRHIQPDPAHCAQLSPHHPHHPQCHSY
CKRQGHWVGQCKKDICQCFS*

FI07238.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 14:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20233-PA 775 GF20233-PA 6..93 17..108 195 47.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 14:36:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19270-PA 116 GG19270-PA 1..116 10..120 379 82.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 14:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24629-PA 133 GH24629-PA 69..133 56..120 177 49.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG34331-PB 111 CG34331-PB 1..111 10..120 624 100 Plus
CG34331-PC 134 CG34331-PC 1..69 10..78 332 95.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 14:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15817-PA 118 GI15817-PA 22..118 30..120 181 41.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 14:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12923-PA 145 GL12923-PA 53..119 48..114 210 55.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 14:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22835-PA 125 GA22835-PA 51..125 46..120 225 53.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 14:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23005-PA 110 GM23005-PA 1..110 10..120 514 88.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 14:36:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17475-PA 111 GD17475-PA 1..111 10..120 479 91.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 14:36:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18669-PA 128 GJ18669-PA 5..128 15..120 202 36.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 14:36:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16338-PA 264 GK16338-PA 69..120 57..108 150 50 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 14:36:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15888-PA 110 GE15888-PA 1..110 10..120 447 88.3 Plus

FI07238.hyp Sequence

Translation from 119 to 532

> FI07238.hyp
MFPIFPHPMPTNWASISERRKMPPTSHWAYSRSRCATFSRTPPTAPSSRH
ITHTTPSATATANAKVTGWASARRTSVSAFPRSTSTVSQNSVFFFLLLSA
AQLYDEICANMFIYQLVYILKLAMNNESESKLLKSYT*
Sequence FI07238.hyp has no blast hits.