Clone FI07240 Report

Search the DGRC for FI07240

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:72
Well:40
Vector:pFlc-1
Associated Gene/TranscriptCG14990-RA
Protein status:FI07240.pep: gold
Sequenced Size:1090

Clone Sequence Records

FI07240.complete Sequence

1090 bp assembled on 2009-10-06

GenBank Submission: BT099958.1

> FI07240.complete
GAGTCGTTTGGAATTTGTGAGCTCAAGCAAACCATGCTCAAGAACTGGAC
AATAAATACGTTCCTTTTGGTTTCGTTTCTTTGTAGTGCGACTGGGCAAA
ATGAAGGAGGAGCACCTGGAATATTCAACGGAATGTCATTCACGGAAAAT
CTTCAACCAGACCCAAATCAAGTTTGCGGCATGAGCAATCCAAATGGCTT
GGTGGCCAATGTGAAGGTGCCCAAAGATTACTCCACACCTGGCCAATTTC
CATGGGTGGTTGCCCTTTTCAGTCAGGGAAAATACTTTGGGGCCGGTTCT
TTGATTGCCCCAGAAGTAGTCCTTACAGCGGCTAGCATTGTGGTGGGCAA
GACTGATGCGGAAATTGTGGTGAGAGCAGGCGAATGGAATACGGGACAAC
GCAGTGAATTCCTACCGTCGGAGGATCGTCCGGTGGCCAGAGTTGTGCAA
CACAGGGAGTTTTCGTATTTATTGGGAGCCAATAACATTGCCCTTCTGTT
CCTAGCCAACCCATTTGAGTTGAAAAGCCACATCCGAACCATCTGCTTGC
CCAGCCAGGGAAGGTCCTTCGATCAGAAGCGCTGCTTGGTGACCGGATGG
GGAAAGGTGGCATTCAACGATGAAAATTACTCAAATATCCAAAAGAAAAT
CGAACTGCCGATGATTAACAGGGCGCAGTGCCAGGATCAGTTGAGAAACA
CCAGATTGGGCGTCTCGTTTGATCTGCCTGCTAGTCTGATATGCGCCGGC
GGCGAGAAGGATGCGGGAGACTGCCTCGGCGACGGAGGATCCGCTCTATT
CTGCCCCATGGAGGCGGACCCATCGCGCTATGAGCAGGCTGGCATCGTTA
ACTGGGGCATCGGCTGTCAAGAGGAAAACGTTCCAGCAGTCTACACAAAT
GTTGAAATGTTTCGGGATTGGATCTATGAGCACATGGCCCAGAACTCCAA
CAGTGTTCCATTCGCTGCTGGTCAGTTACCATCGAACTATAAACAGGAAT
AAGCTTTTACATTACATTAAGCATTAATAATACATTAAAATAATAATACT
CCTCGAAAGAGGCCATCTTCTGTAAAAAAAAAAAAAAAAA

FI07240.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG14990-RA 1108 CG14990-RA 37..1108 2..1073 5360 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:22:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4092769..4093730 112..1073 4810 100 Plus
chr3L 24539361 chr3L 4092593..4092703 2..112 555 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:22:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG14990-RA 969 CG14990-PA 1..969 34..1002 4845 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:18 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG14990-RA 1072 CG14990-RA 1..1072 2..1073 5360 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:22:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG14990-PA 322 CG14990-PA 1..322 34..999 1715 100 Plus
CG18478-PA 294 CG18478-PA 21..287 145..945 720 50.2 Plus
CG31827-PA 294 CG31827-PA 21..287 145..945 720 50.2 Plus
SPH93-PA 494 CG6639-PA 214..486 100..936 703 50 Plus
CG3117-PB 347 CG3117-PB 82..334 184..942 659 47.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4093383..4094344 112..1073 4810 100 Plus
3L 28110227 3L 4093207..4093317 2..112 555 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:49:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4093383..4094344 112..1073 4810 100 Plus
3L 28103327 3L 4093207..4093317 2..112 555 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:22:27 has no hits.

FI07240.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:10:31 Download gff for FI07240.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4092769..4093730 112..1073 100   Plus
chr3L 4092592..4092702 1..111 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:51 Download gff for FI07240.complete
Subject Subject Range Query Range Percent Splice Strand
CG14990-RA 1..969 34..1002 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:41:07 Download gff for FI07240.complete
Subject Subject Range Query Range Percent Splice Strand
CG14990-RA 1..969 34..1002 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:12:57 Download gff for FI07240.complete
Subject Subject Range Query Range Percent Splice Strand
CG14990-RA 1..969 34..1002 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:10:31 Download gff for FI07240.complete
Subject Subject Range Query Range Percent Splice Strand
CG14990-RA 1..969 34..1002 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-06 14:14:58 Download gff for FI07240.complete
Subject Subject Range Query Range Percent Splice Strand
CG14990-RA 2..1073 2..1073 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:41:07 Download gff for FI07240.complete
Subject Subject Range Query Range Percent Splice Strand
CG14990-RA 2..1073 2..1073 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:12:57 Download gff for FI07240.complete
Subject Subject Range Query Range Percent Splice Strand
CG14990-RA 1..1072 2..1073 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:10:31 Download gff for FI07240.complete
Subject Subject Range Query Range Percent Splice Strand
CG14990-RA 1..1072 2..1073 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:10:31 Download gff for FI07240.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4093383..4094344 112..1073 100   Plus
3L 4093206..4093316 1..111 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:12:57 Download gff for FI07240.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4093383..4094344 112..1073 100   Plus
arm_3L 4093206..4093316 1..111 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:22:51 Download gff for FI07240.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4093383..4094344 112..1073 100   Plus
3L 4093206..4093316 1..111 99 -> Plus

FI07240.pep Sequence

Translation from 0 to 1001

> FI07240.pep
ESFGICELKQTMLKNWTINTFLLVSFLCSATGQNEGGAPGIFNGMSFTEN
LQPDPNQVCGMSNPNGLVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGS
LIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQ
HREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSFDQKRCLVTGW
GKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAG
GEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTN
VEMFRDWIYEHMAQNSNSVPFAAGQLPSNYKQE*

FI07240.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13091-PA 347 GF13091-PA 88..347 57..329 671 47.3 Plus
Dana\GF11134-PA 345 GF11134-PA 80..342 48..312 580 43.2 Plus
Dana\GF14116-PA 400 GF14116-PA 128..399 53..314 562 44.1 Plus
Dana\GF13730-PA 383 GF13730-PA 84..333 59..308 532 43.3 Plus
Dana\GF19829-PA 216 GF19829-PA 3..196 121..314 516 46.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24481-PA 341 GG24481-PA 71..329 59..317 634 48.8 Plus
Dere\GG23951-PA 413 GG23951-PA 134..397 51..308 602 45.8 Plus
Dere\GG23377-PA 447 GG23377-PA 176..439 59..315 533 40.5 Plus
Dere\GG25170-PA 442 GG25170-PA 67..341 27..308 529 38.7 Plus
Dere\GG10625-PA 437 GG10625-PA 165..427 59..312 523 39.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13850-PA 400 GH13850-PA 124..400 54..323 623 46.6 Plus
Dgri\GH10384-PA 371 GH10384-PA 94..353 57..312 606 45.8 Plus
Dgri\GH20108-PA 389 GH20108-PA 109..380 51..315 527 43.6 Plus
Dgri\GH21265-PA 363 GH21265-PA 96..353 59..314 522 41.8 Plus
Dgri\GH20539-PA 450 GH20539-PA 181..439 59..310 515 42.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG14990-PA 322 CG14990-PA 1..322 12..333 1715 100 Plus
CG18478-PA 294 CG18478-PA 21..287 49..315 720 50.2 Plus
CG31827-PA 294 CG31827-PA 21..287 49..315 720 50.2 Plus
SPH93-PA 494 CG6639-PA 214..486 34..312 703 50 Plus
CG3117-PB 347 CG3117-PB 82..334 62..314 659 47.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19467-PA 398 GI19467-PA 127..387 59..313 621 47.1 Plus
Dmoj\GI24370-PA 420 GI24370-PA 140..411 51..315 527 41.8 Plus
Dmoj\GI18807-PA 438 GI18807-PA 168..430 59..314 505 39.5 Plus
Dmoj\GI20774-PA 454 GI20774-PA 179..443 57..312 493 39.2 Plus
Dmoj\GI23068-PA 387 GI23068-PA 130..386 56..313 426 39.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:01:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15455-PA 294 GL15455-PA 33..290 54..312 763 53.7 Plus
Dper\GL26716-PA 298 GL26716-PA 33..295 54..317 757 53 Plus
Dper\GL26286-PA 294 GL26286-PA 33..290 54..312 743 52.9 Plus
Dper\GL15454-PA 525 GL15454-PA 92..353 59..318 658 48.1 Plus
Dper\GL26715-PA 220 GL26715-PA 2..210 110..319 629 56.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29220-PA 290 GA29220-PA 33..290 54..312 759 53.7 Plus
Dpse\GA29037-PA 335 GA29037-PA 74..331 54..312 755 53.3 Plus
Dpse\GA29036-PA 484 GA29036-PA 92..353 59..318 659 48.1 Plus
Dpse\GA26264-PA 429 GA26264-PA 149..420 51..315 561 45.4 Plus
Dpse\GA21292-PA 462 GA21292-PA 181..453 49..314 528 40.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:01:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17127-PA 447 GM17127-PA 183..436 59..312 738 53.3 Plus
Dsec\GM18188-PA 346 GM18188-PA 75..333 56..314 687 48.6 Plus
Dsec\GM11791-PA 405 GM11791-PA 125..389 50..308 607 45.7 Plus
Dsec\GM18189-PA 340 GM18189-PA 69..326 59..317 570 46.2 Plus
Dsec\GM18641-PA 510 GM18641-PA 80..343 52..316 561 44.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:01:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13811-PA 323 GD13811-PA 1..317 12..329 1507 89.3 Plus
Dsim\GD10182-PA 326 GD10182-PA 70..312 74..316 749 56.8 Plus
Dsim\GD21869-PA 544 GD21869-PA 278..531 59..312 713 52.5 Plus
Dsim\GD22795-PA 346 GD22795-PA 75..333 56..314 689 49.4 Plus
Dsim\GD21938-PA 362 GD21938-PA 74..342 50..318 606 44.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:01:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21928-PA 395 GJ21928-PA 119..392 54..321 647 46.7 Plus
Dvir\GJ18190-PA 289 GJ18190-PA 20..284 59..314 641 47.2 Plus
Dvir\GJ18191-PA 478 GJ18191-PA 173..447 49..312 574 42.2 Plus
Dvir\GJ18039-PA 571 GJ18039-PA 290..559 45..312 559 42.7 Plus
Dvir\GJ21834-PA 442 GJ21834-PA 176..437 59..313 501 38.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24265-PA 294 GK24265-PA 25..294 59..323 616 45.6 Plus
Dwil\GK19365-PA 210 GK19365-PA 5..210 121..323 515 47.6 Plus
Dwil\GK21569-PA 454 GK21569-PA 182..440 59..308 502 39 Plus
Dwil\GK21734-PA 470 GK21734-PA 189..468 57..320 494 37.9 Plus
Dwil\GK11266-PA 405 GK11266-PA 172..405 81..314 424 41 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21411-PA 305 GE21411-PA 1..305 12..323 1194 71.8 Plus
Dyak\GE13135-PA 485 GE13135-PA 224..475 59..310 721 53 Plus
Dyak\GE14996-PA 337 GE14996-PA 79..331 62..314 676 50.6 Plus
Dyak\GE19385-PA 366 GE19385-PA 87..350 59..326 617 47 Plus
Dyak\GE14999-PA 337 GE14999-PA 65..323 59..317 602 47.3 Plus

FI07240.hyp Sequence

Translation from 33 to 1001

> FI07240.hyp
MLKNWTINTFLLVSFLCSATGQNEGGAPGIFNGMSFTENLQPDPNQVCGM
SNPNGLVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAA
SIVVGKTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGAN
NIALLFLANPFELKSHIRTICLPSQGRSFDQKRCLVTGWGKVAFNDENYS
NIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGDCLGD
GGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEH
MAQNSNSVPFAAGQLPSNYKQE*

FI07240.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG14990-PA 322 CG14990-PA 1..322 1..322 1715 100 Plus
CG18478-PA 294 CG18478-PA 21..287 38..304 720 50.2 Plus
CG31827-PA 294 CG31827-PA 21..287 38..304 720 50.2 Plus
SPH93-PA 494 CG6639-PA 214..486 23..301 703 50 Plus
CG3117-PB 347 CG3117-PB 82..334 51..303 659 47.8 Plus