Clone FI07254 Report

Search the DGRC for FI07254

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:72
Well:54
Vector:pFlc-1
Associated Gene/TranscriptTwdlC-RA
Protein status:FI07254.pep: gold
Sequenced Size:1407

Clone Sequence Records

FI07254.complete Sequence

1407 bp assembled on 2009-10-14

GenBank Submission: BT100102.1

> FI07254.complete
ATCAGTCGAGCATCGAGCTTCTCCATCGAAGCATTTCATCGAGCCAAAGG
ATTACGGGCTTACTAAGCAGCAAAGGATTTCCGATTACCAGAAGCAAAAT
GCGTGTCTCCTCGCTGTTCGTTGTGTGCGTGGCCTCCCTGGTGGCCACCA
CTTTGGGTCGTCCTGAGCCCCCATCCCCGTACTCCTACCACGGATTGCCT
CAGCAGCAGAGCCAGCGGGCTTTGCCACTCAATGCTCACCCCGTTCCCCC
GCAGATTTACCAGCCTCTGCCCCAGGAGCAGTCGTTTGCCAACTTTGCAC
CGCCCCAGCAGACCTACTTGCCACCCCAAATGCATCTGGATGCCATCGAG
CAAGTGGCTCCCACTGCCGCCGCCGCTGAGCCCCTGAATGCCTACGATGA
CAGCTACAACATGGCCCACCGCCTGTCCGGAGTGCAGCATGCCAGTGGCT
ACAACAATGGCCCCCAGGAGACCAAGGTGCACAAGCACATCTACGTCCAT
GTGCCGCCAAAGGACTTCGAGGAGGAGGATGCCATCCAGACCCGAGTTCA
CCACCAGCAGGGACCCAAGCAGAAGCACTACAAGATCGTGTTCATCAAGG
CACCATCTGCTCCGGCTATCCGTCAGCCAGTTGTGCCACCACCACCCCAG
AATGAGGAGAAGACTCTGATCTATGTGCTGCACAAGAAGCCCGAGCAGGA
GCAAGATATCGTGATCCCGACGCCACCACCCACCAAGCCATCGAAGCCAG
AGGTTTACTTCATCAAGTACAAGACCAAGAAGGACGAGGCCCCCGTCTAT
GGACCCCCACCTGCAGAGATGGAGCCCCGTCAGGCCACCGCCGAGGATTT
CGCTCCATTGGCTGAGGTCGCCGATGTCCTGCCACCCACCACCCTGGCTC
CTGCTCCCGAGCCGGAAGTAGAGCAGCCAGCCATTCCCTCCGCGGTCTAC
GGACCACCCACTGCAGCTGCCTATACTGGTGAGGAGGTTCAGACCACCTT
GTCCGCTCCTGCCAACCAGTATCTGCCCCCTGCCACCGCTCCCGCCGCCC
TGGCCATTGAGGAGCCCTCAATGGCGCCCATCGTGGTGGAGGAACAGCCC
GAGCAGCGACTGGCTCCTTCCCATGTGCCTGCCACCAGCTACGGTCCTCC
CAACCGCTACTTCCTTAAGAAGCTGAAGTGAAGCCCGCTGCTTTGAGATG
GTGATGCCTTAGCCAATTTCACAGTTTGTCATAGTCTAATGTCCATTGGA
TGCACCTCTTCCCAATCCCCTGTTCCCAATTCACACATGCACACGTGCCA
AACCTCCCCACATGCACATCTCGTTGTTTGTTCGTTTGTATAACTTGTTA
CGTTTGTTTTAATAAAGAGTAGATAATAAATATCAAATTTATAAAAAAAA
AAAAAAA

FI07254.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlC-RA 1426 TwdlC-RA 24..1425 1..1402 6995 99.9 Plus
TwdlT-RA 1717 TwdlT-RA 779..915 648..784 370 84.6 Plus
TwdlT-RA 1717 TwdlT-RA 701..738 570..607 145 92.1 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22818350..22819508 234..1392 5660 99.2 Plus
chr3R 27901430 chr3R 22817910..22818143 1..234 1155 99.6 Plus
chr3R 27901430 chr3R 22873161..22873297 648..784 370 84.7 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlC-RA 1083 CG14254-PA 1..1083 99..1181 5415 100 Plus
TwdlT-RA 861 CG5812-PA 553..689 648..784 370 84.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:29 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlC-RA 1396 CG14254-RA 5..1396 1..1392 6945 99.9 Plus
TwdlT-RA 1607 CG5812-RA 743..879 648..784 370 84.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlC-PA 360 CG14254-PA 1..355 99..1163 1458 100 Plus
TwdlT-PA 286 CG5812-PA 121..236 447..803 276 62.2 Plus
TwdlE-PA 197 CG14534-PA 49..195 441..857 260 51.3 Plus
TwdlBeta-PA 198 CG8986-PA 1..180 99..815 228 36.5 Plus
TwdlG-PC 278 CG14643-PC 96..246 444..869 179 39.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26995284..26996452 234..1402 5830 99.9 Plus
3R 32079331 3R 26994836..26995069 1..234 1170 100 Plus
3R 32079331 3R 27050140..27050276 648..784 370 84.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:51:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26736115..26737283 234..1402 5830 99.9 Plus
3R 31820162 3R 26735667..26735900 1..234 1170 100 Plus
3R 31820162 3R 26790971..26791107 648..784 370 84.6 Plus
3R 31820162 3R 26790893..26790930 570..607 145 92.1 Plus
Blast to na_te.dros performed 2014-11-27 11:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
R1A1-element 5356 R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). 616..769 954..1113 120 56.8 Plus

FI07254.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:25:41 Download gff for FI07254.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22818351..22819488 235..1372 99   Plus
chr3R 22817910..22818143 1..234 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:58:26 Download gff for FI07254.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlC-RA 1..1083 99..1181 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:45:01 Download gff for FI07254.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlC-RA 1..1083 99..1181 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:42:54 Download gff for FI07254.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlC-RA 1..1083 99..1181 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:25:41 Download gff for FI07254.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlC-RA 1..1083 99..1181 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-14 12:21:54 Download gff for FI07254.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlC-RA 1..1181 1..1181 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:45:01 Download gff for FI07254.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlC-RA 1..1392 1..1392 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:42:54 Download gff for FI07254.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlC-RA 5..1396 1..1392 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:25:41 Download gff for FI07254.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlC-RA 5..1396 1..1392 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:25:41 Download gff for FI07254.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26995285..26996442 235..1392 99   Plus
3R 26994836..26995069 1..234 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:42:54 Download gff for FI07254.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22821007..22822164 235..1392 99   Plus
arm_3R 22820558..22820791 1..234 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:25:32 Download gff for FI07254.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26736116..26737273 235..1392 99   Plus
3R 26735667..26735900 1..234 100 -> Plus

FI07254.pep Sequence

Translation from 2 to 1180

> FI07254.pep
QSSIELLHRSISSSQRITGLLSSKGFPITRSKMRVSSLFVVCVASLVATT
LGRPEPPSPYSYHGLPQQQSQRALPLNAHPVPPQIYQPLPQEQSFANFAP
PQQTYLPPQMHLDAIEQVAPTAAAAEPLNAYDDSYNMAHRLSGVQHASGY
NNGPQETKVHKHIYVHVPPKDFEEEDAIQTRVHHQQGPKQKHYKIVFIKA
PSAPAIRQPVVPPPPQNEEKTLIYVLHKKPEQEQDIVIPTPPPTKPSKPE
VYFIKYKTKKDEAPVYGPPPAEMEPRQATAEDFAPLAEVADVLPPTTLAP
APEPEVEQPAIPSAVYGPPTAAAYTGEEVQTTLSAPANQYLPPATAPAAL
AIEEPSMAPIVVEEQPEQRLAPSHVPATSYGPPNRYFLKKLK*

FI07254.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23265-PA 369 GF23265-PA 1..369 33..392 1399 86.8 Plus
Dana\GF23268-PA 286 GF23268-PA 131..232 157..261 325 66.7 Plus
Dana\GF11806-PA 195 GF11806-PA 56..181 147..274 263 52.3 Plus
Dana\GF22833-PA 197 GF22833-PA 87..162 188..263 231 72.4 Plus
Dana\GF22662-PA 385 GF22662-PA 155..304 153..301 211 37.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11517-PA 360 GG11517-PA 1..360 33..392 1801 98.1 Plus
Dere\GG11520-PA 282 GG11520-PA 125..226 157..261 331 67.6 Plus
Dere\GG22628-PA 198 GG22628-PA 67..180 156..271 261 52.5 Plus
Dere\GG23499-PA 197 GG23499-PA 87..162 188..263 231 72.4 Plus
Dere\GG19076-PA 427 GG19076-PA 179..328 153..301 205 37.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:03:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18628-PA 365 GH18628-PA 1..365 33..392 1238 71.5 Plus
Dgri\GH18631-PA 293 GH18631-PA 137..238 157..261 327 66.7 Plus
Dgri\GH22882-PA 193 GH22882-PA 53..172 147..269 274 52.4 Plus
Dgri\GH11556-PA 196 GH11556-PA 87..162 188..263 216 71.1 Plus
Dgri\GH21845-PA 288 GH21845-PA 101..211 150..263 184 47.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:03:53
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlC-PA 360 CG14254-PA 1..360 33..392 1914 100 Plus
TwdlT-PA 286 CG5812-PA 121..236 149..267 378 62.2 Plus
TwdlE-PA 197 CG14534-PA 24..196 127..320 367 44.2 Plus
TwdlBeta-PA 198 CG8986-PA 23..180 100..271 336 44.9 Plus
TwdlG-PC 278 CG14643-PC 15..250 64..293 232 34.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:04:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24299-PA 357 GI24299-PA 1..357 33..392 1225 74.5 Plus
Dmoj\GI21267-PA 201 GI21267-PA 1..179 33..269 279 38.8 Plus
Dmoj\GI17047-PA 196 GI17047-PA 87..161 188..262 225 74.7 Plus
Dmoj\GI10848-PA 268 GI10848-PA 86..267 159..344 198 31.1 Plus
Dmoj\GI14656-PA 374 GI14656-PA 169..304 159..293 191 37.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:04:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23893-PA 392 GL23893-PA 1..391 33..389 1440 79.1 Plus
Dper\GL23896-PA 263 GL23896-PA 130..218 157..248 269 63 Plus
Dper\GL10248-PA 181 GL10248-PA 83..167 190..274 240 60 Plus
Dper\GL19485-PA 197 GL19485-PA 87..171 188..275 233 67 Plus
Dper\GL12334-PA 296 GL12334-PA 131..277 159..302 187 39.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:04:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27091-PA 375 GA27091-PA 1..375 33..392 1416 83.5 Plus
Dpse\GA22498-PA 375 GA22498-PA 1..375 33..392 1412 83.2 Plus
Dpse\GA19149-PA 293 GA19149-PA 130..231 157..261 329 66.7 Plus
Dpse\GA21455-PA 197 GA21455-PA 71..183 159..274 266 54.6 Plus
Dpse\GA25978-PA 197 GA25978-PA 87..162 188..263 232 72.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10357-PA 360 GM10357-PA 1..360 33..392 1812 99.2 Plus
Dsec\GM10360-PA 281 GM10360-PA 116..211 157..255 305 66.7 Plus
Dsec\GM13288-PA 197 GM13288-PA 61..162 159..263 266 63.8 Plus
Dsec\GM20406-PA 196 GM20406-PA 65..178 156..271 261 52.5 Plus
Dsec\GM20554-PA 382 GM20554-PA 155..304 153..301 208 37.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21319-PA 360 GD21319-PA 1..360 33..392 1824 99.4 Plus
Dsim\GD25881-PA 198 GD25881-PA 67..180 156..271 262 52.5 Plus
Dsim\GD22462-PA 197 GD22462-PA 61..162 159..263 261 62.9 Plus
Dsim\GD17305-PA 405 GD17305-PA 170..319 153..301 209 37.3 Plus
Dsim\GD19694-PA 278 GD19694-PA 113..250 159..293 188 43.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23078-PA 369 GJ23078-PA 1..369 33..392 1244 74.2 Plus
Dvir\GJ23081-PA 283 GJ23081-PA 129..230 157..261 324 66.7 Plus
Dvir\GJ20869-PA 197 GJ20869-PA 71..197 156..283 257 51.1 Plus
Dvir\GJ10078-PA 196 GJ10078-PA 87..162 188..263 222 73.7 Plus
Dvir\GJ14291-PA 281 GJ14291-PA 101..250 149..293 188 41.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:04:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11037-PA 277 GK11037-PA 1..102 33..131 368 74.3 Plus
Dwil\GK11039-PA 272 GK11039-PA 115..216 157..261 327 67.6 Plus
Dwil\GK17917-PA 195 GK17917-PA 5..176 38..269 278 39.6 Plus
Dwil\GK23969-PA 196 GK23969-PA 87..162 188..263 229 71.1 Plus
Dwil\GK13401-PA 428 GK13401-PA 257..362 161..262 215 51.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23705-PA 360 GE23705-PA 1..360 33..392 1809 98.6 Plus
Dyak\GE23709-PA 275 GE23709-PA 122..223 157..261 329 67.6 Plus
Dyak\GE13497-PA 198 GE13497-PA 67..180 156..271 262 52.5 Plus
Dyak\GE18328-PA 197 GE18328-PA 87..162 188..263 230 72.4 Plus
Dyak\GE17621-PA 429 GE17621-PA 195..344 153..301 209 37.3 Plus

FI07254.hyp Sequence

Translation from 2 to 1180

> FI07254.hyp
QSSIELLHRSISSSQRITGLLSSKGFPITRSKMRVSSLFVVCVASLVATT
LGRPEPPSPYSYHGLPQQQSQRALPLNAHPVPPQIYQPLPQEQSFANFAP
PQQTYLPPQMHLDAIEQVAPTAAAAEPLNAYDDSYNMAHRLSGVQHASGY
NNGPQETKVHKHIYVHVPPKDFEEEDAIQTRVHHQQGPKQKHYKIVFIKA
PSAPAIRQPVVPPPPQNEEKTLIYVLHKKPEQEQDIVIPTPPPTKPSKPE
VYFIKYKTKKDEAPVYGPPPAEMEPRQATAEDFAPLAEVADVLPPTTLAP
APEPEVEQPAIPSAVYGPPTAAAYTGEEVQTTLSAPANQYLPPATAPAAL
AIEEPSMAPIVVEEQPEQRLAPSHVPATSYGPPNRYFLKKLK*

FI07254.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlC-PA 360 CG14254-PA 1..360 33..392 1914 100 Plus
TwdlT-PA 286 CG5812-PA 121..236 149..267 378 62.2 Plus
TwdlE-PA 197 CG14534-PA 24..196 127..320 367 44.2 Plus
TwdlBeta-PA 198 CG8986-PA 23..180 100..271 336 44.9 Plus
TwdlG-PC 278 CG14643-PC 15..250 64..293 232 34.8 Plus