Clone FI07314 Report

Search the DGRC for FI07314

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:73
Well:14
Vector:pFlc-1
Associated Gene/TranscriptCG14423-RA
Protein status:FI07314.pep: gold
Sequenced Size:1203

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14423 2008-12-18 5.12 accounting

Clone Sequence Records

FI07314.complete Sequence

1203 bp assembled on 2008-11-04

GenBank Submission: BT050511.1

> FI07314.complete
ATCAAAGCCTGATTGTCCAGCCATCGGCGAGCAACAGAAATCGCAGCGAT
TTTGGTCTATCCGAAAAGTTCTCTTCTTTAACCAGAGTAGTTTCCCGAAG
ACCCAAAAGAGTTTATAAATTTATCCAACATGAAGTTGTACGCCATCGTT
ATCCTTTCGGCATGCTGTCTTCTAGCCGCACAAGCGGCACCCGAGAAGAA
GATGGCCCTGAAGTCGCGTCAAGTCGACCAGGATGCCAAGGTGGGCCAGG
CCGCTTCCAGTGCTGGTGCATCGACCTCTGCCAAGGATCCCTCCAGTGGC
AGGCTGTTTCTCAAAAAGTTCCTAACCTTCAAGAACCTGTTTAGCAGCAA
CAATCAACCCGTGATTCCGATCATTATCACCGGCGCCGGAACCGGGACTA
GCACAGGAGCCTCACCCACTTCGCCCACGGTGACAGTGACCTCGACAGGC
ACCATTCCCTCGGCCACTGGCACCATTACCACTTCGCCCACAACACCCAC
CTCGACGACATCGAGCGCACGGCAAACGATTATCAAGGGTGCCCGATATG
GCAGCAACGATGACGACCAGGAGCAGAATCAGGAACAGGATCAGGATCAG
GACCAAGAACAGGACCAGGAGCTGGCCCAACCCGCACAGGCCTACCCCGC
CGAGTTGATGGACGAGCAGGCTCTGCAGGCCGCCCTGGCCGCTGGCGCCC
AGGAATACGAGGTGGTCACCACTGAGCACGAGGTCCAGGGAACTGGCGGA
GCCACCGTCGAAGGCGGCAAGGCCACCCAAAGCAATAACCATATCAGTCT
GCGACGCAAAGGCGCCCGCCGCGGCCAGGTGATCAGCGTTCGCATCCCAC
CCCGCTACCGCCGCTACTTCAAGAACGGCCAGAAGGTGATGCTCAATACC
GGTAGTCGTCCCGTCTCCAAGCGTCGCGTGGTTCGCAAGCGAGTGCCTGC
CAAGAAAATCAACAAGAACAACCGGAGGCGCAACGGCAACAAGAAGAATC
GTCGCAATCGCAACAAGAACCGTCGCAATCGCATCACCGCCGTCTAAGGA
TCTAGGATTCAAGGTCAGGATCCAACGATCCGACACATTCCGGCAAGATA
ATTTTTTTTTCTAATTTATTGTAGCCTAACTTGCTACTGCCACACTTCCT
GCGGCAGGATAAACGATAAATAAAGCCCTTCAAGAATAAAAAAAAAAAAA
AAA

FI07314.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:12:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG14423-RA 1194 CG14423-RA 1..1194 1..1194 5940 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2839196..2840382 1..1187 5860 99.6 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG14423-RA 918 CG14423-PA 1..918 130..1047 4575 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:34 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:28:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG14423-RA 1187 CG14423-RA 1..1187 1..1187 5920 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG14423-PA 305 CG14423-PA 1..258 130..903 526 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:28:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2945403..2946596 1..1194 5940 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2953501..2954694 1..1194 5940 99.8 Plus
Blast to na_te.dros performed on 2014-11-27 05:28:16 has no hits.

FI07314.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:35:37 Download gff for FI07314.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2839816..2840382 621..1187 99   Plus
chrX 2839196..2839759 1..564 99 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:55:37 Download gff for FI07314.complete
Subject Subject Range Query Range Percent Splice Strand
CG14423-RA 1..918 130..1047 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:18:16 Download gff for FI07314.complete
Subject Subject Range Query Range Percent Splice Strand
CG14423-RA 1..918 130..1047 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:38:48 Download gff for FI07314.complete
Subject Subject Range Query Range Percent Splice Strand
CG14423-RA 1..918 130..1047 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:35:37 Download gff for FI07314.complete
Subject Subject Range Query Range Percent Splice Strand
CG14423-RA 1..918 130..1047 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:58:37 Download gff for FI07314.complete
Subject Subject Range Query Range Percent Splice Strand
CG14423-RA 1..1187 1..1187 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:18:16 Download gff for FI07314.complete
Subject Subject Range Query Range Percent Splice Strand
CG14423-RA 1..1187 1..1187 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:38:48 Download gff for FI07314.complete
Subject Subject Range Query Range Percent Splice Strand
CG14423-RA 1..1187 1..1187 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 14:10:04 Download gff for FI07314.complete
Subject Subject Range Query Range Percent Splice Strand
CG14423-RA 1..1187 1..1187 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:35:37 Download gff for FI07314.complete
Subject Subject Range Query Range Percent Splice Strand
CG14423-RA 1..1187 1..1187 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:35:37 Download gff for FI07314.complete
Subject Subject Range Query Range Percent Splice Strand
X 2945403..2946589 1..1187 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:38:48 Download gff for FI07314.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2839436..2840622 1..1187 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:49:28 Download gff for FI07314.complete
Subject Subject Range Query Range Percent Splice Strand
X 2953501..2954687 1..1187 99   Plus

FI07314.pep Sequence

Translation from 129 to 1046

> FI07314.pep
MKLYAIVILSACCLLAAQAAPEKKMALKSRQVDQDAKVGQAASSAGASTS
AKDPSSGRLFLKKFLTFKNLFSSNNQPVIPIIITGAGTGTSTGASPTSPT
VTVTSTGTIPSATGTITTSPTTPTSTTSSARQTIIKGARYGSNDDDQEQN
QEQDQDQDQEQDQELAQPAQAYPAELMDEQALQAALAAGAQEYEVVTTEH
EVQGTGGATVEGGKATQSNNHISLRRKGARRGQVISVRIPPRYRRYFKNG
QKVMLNTGSRPVSKRRVVRKRVPAKKINKNNRRRNGNKKNRRNRNKNRRN
RITAV*

FI07314.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22467-PA 189 GF22467-PA 52..163 165..277 355 77.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18641-PA 315 GG18641-PA 1..282 1..274 720 85.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12480-PA 326 GH12480-PA 80..290 45..272 398 55.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:52:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG14423-PA 305 CG14423-PA 1..305 1..305 1532 100 Plus
CG14422-PA 294 CG14422-PA 14..291 36..301 174 25.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11164-PA 319 GI11164-PA 81..272 49..257 347 57.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19939-PA 76 GL19939-PA 3..49 235..284 175 80 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12973-PA 329 GA12973-PA 65..302 31..284 519 62.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19260-PA 306 GM19260-PA 1..275 1..274 875 97.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:53:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15294-PA 327 GJ15294-PA 87..282 52..261 382 62.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18852-PA 325 GK18852-PA 45..280 52..272 441 62.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:53:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16290-PA 312 GE16290-PA 1..280 1..274 826 86.8 Plus

FI07314.hyp Sequence

Translation from 129 to 1046

> FI07314.hyp
MKLYAIVILSACCLLAAQAAPEKKMALKSRQVDQDAKVGQAASSAGASTS
AKDPSSGRLFLKKFLTFKNLFSSNNQPVIPIIITGAGTGTSTGASPTSPT
VTVTSTGTIPSATGTITTSPTTPTSTTSSARQTIIKGARYGSNDDDQEQN
QEQDQDQDQEQDQELAQPAQAYPAELMDEQALQAALAAGAQEYEVVTTEH
EVQGTGGATVEGGKATQSNNHISLRRKGARRGQVISVRIPPRYRRYFKNG
QKVMLNTGSRPVSKRRVVRKRVPAKKINKNNRRRNGNKKNRRNRNKNRRN
RITAV*

FI07314.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:31:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG14423-PA 305 CG14423-PA 1..305 1..305 1532 100 Plus
CG14422-PA 294 CG14422-PA 14..291 36..301 174 25.8 Plus