Clone FI07335 Report

Search the DGRC for FI07335

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:73
Well:35
Vector:pFlc-1
Associated Gene/TranscriptCG2974-RB
Protein status:FI07335.pep: gold
Sequenced Size:1215

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2974 2008-12-18 5.12 accounting

Clone Sequence Records

FI07335.complete Sequence

1215 bp assembled on 2008-11-04

GenBank Submission: BT050512.1

> FI07335.complete
GAACTCTGCAATCAGCTGTTTGAGAACTTAAAAGTTTATTTTCAAACAAC
CCAAACATTTAAAATTGATTTCCTCAAGGAAATATAGTTAAATAAAACTC
GAAATCTATGAGCCTGATTTGCCGTCGATTTGGCTCTTCCTTGAGGCCCA
TCGCCCGCACACTCCACCCACTGCTCGCCAGCAAAATCATCGAAGCACAA
AGGTCACCGCTGAAAAACAAGCGATTTTACGCCGGCAAGAGAATGGATTT
AAAGTATCTAAATCAAAAGGAGGCCATCGCCGTGGACCAGGAACTATTCA
ACGATTACAAGTTCAGTGTGGATCAGCTAATGGAGCTGGCGGGCTTGAGC
TGCGCCCATGCTGTGGCCAAATGCTTCCCGGCAGAGAAGCATCCACGAAT
TCTCGTTTGCTGTGGACCAGGAAACAATGGAGGCGACGGCTTGGTTGCCG
CCCGCCACCTCGCCCTCATGGGCTACACACCCACCATCTACTATCCCAAG
CCGACGGCCAAGCCGCTCTTCGAGAACCTCAGCCACCAGTGCCAACAGAT
GGACATCTGCGACGTGAAGGAGTGTCCGTCGGTGGAGAGTGCCGCCCGTG
ACTATGATCTCATTCTGGATGCGCTCTTCGGATTCAGCTTCAAGCCGCCG
GTGCGAGCGGACTTTGTCGCCGTCGTGGAACTAATGCAGCAGACCAAACT
GCCAATTGCCAGCGTGGACATTCCCAGCGGCTGGGATGTGGAGAAGGGCA
AGCTGACTGAATGCGACGTGGAGCCGGCTCTGCTCATTTCCCTCACTGCG
CCGAAACTCTGTGCCCGCCAATTTCGCGGCGAACATCACTACTTGGGCGG
CAGATTCGTGCCGCCCGCCCTGCAGCGCAAATACGAACTGAATCTGCCCG
TTTATCCGGGCAACGAGCTGTGCGTCAAGCTGTGATTTCTGCATTTATGC
GGTTTCCCAATAAACGATGGAGTCTTGAGCCGCAACGTCTGGTTTCCATC
CATCATTTGAAATGAATTCTTTGTTGAAACAGCGACTATTTTGATTTCCA
GAAGCAGCAAACACAATGTTCAATTAAAAACAGATTTAATTACGTTAAAA
AAATGAAACTTAATGCTAGTTCATAACAAAAAAAAAGATTTTCTAGCTTT
TAACTTTGTAAATAAATATTGGAATTAGAATCCAAGAAAAACTCCATACC
CTAAAAAAAAAAAAA

FI07335.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG2974-RB 1229 CG2974-RB 13..1226 2..1215 6010 99.6 Plus
CG2972-RA 1838 CG2972-RA 1688..1838 1215..1065 695 97.3 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 9977119..9977829 712..2 3450 99 Minus
chrX 22417052 chrX 9976574..9977063 1198..710 2280 98.2 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:30:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG2974-RB 693 CG2974-PB 1..693 243..935 3465 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:38 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:30:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG2974-RB 1200 CG2974-RB 1..1199 2..1200 5995 100 Plus
CG2972-RB 1838 CG2972-RB 1703..1838 1200..1065 680 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG2974-PB 230 CG2974-PB 1..230 243..932 1230 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:30:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10085461..10086171 712..2 3555 100 Minus
X 23542271 X 10084900..10085405 1215..710 2470 99.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 10093559..10094269 712..2 3555 100 Minus
X 23527363 X 10092998..10093503 1215..710 2470 99.2 Minus
Blast to na_te.dros performed on 2014-11-27 03:30:38 has no hits.

FI07335.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:55:24 Download gff for FI07335.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 9977119..9977829 1..712 98   Minus
chrX 9976570..9977060 713..1202 97 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:55:40 Download gff for FI07335.complete
Subject Subject Range Query Range Percent Splice Strand
CG2974-RB 1..693 243..935 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:18:07 Download gff for FI07335.complete
Subject Subject Range Query Range Percent Splice Strand
CG2974-RB 1..693 243..935 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:14:13 Download gff for FI07335.complete
Subject Subject Range Query Range Percent Splice Strand
CG2974-RB 1..693 243..935 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:55:24 Download gff for FI07335.complete
Subject Subject Range Query Range Percent Splice Strand
CG2974-RB 1..693 243..935 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:58:34 Download gff for FI07335.complete
Subject Subject Range Query Range Percent Splice Strand
CG2974-RB 1..1200 2..1202 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:18:07 Download gff for FI07335.complete
Subject Subject Range Query Range Percent Splice Strand
CG2974-RB 1..1200 2..1202 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:14:13 Download gff for FI07335.complete
Subject Subject Range Query Range Percent Splice Strand
CG2974-RB 1..1200 2..1202 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 14:10:01 Download gff for FI07335.complete
Subject Subject Range Query Range Percent Splice Strand
CG2974-RB 1..1200 2..1202 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:55:24 Download gff for FI07335.complete
Subject Subject Range Query Range Percent Splice Strand
CG2974-RB 1..1200 2..1202 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:55:24 Download gff for FI07335.complete
Subject Subject Range Query Range Percent Splice Strand
X 10085461..10086171 1..712 99   Minus
X 10084913..10085402 713..1202 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:14:13 Download gff for FI07335.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9979494..9980204 1..712 99   Minus
arm_X 9978946..9979435 713..1202 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:49:19 Download gff for FI07335.complete
Subject Subject Range Query Range Percent Splice Strand
X 10093559..10094269 1..712 99   Minus
X 10093011..10093500 713..1202 99 <- Minus

FI07335.pep Sequence

Translation from 107 to 934

> FI07335.pep
MSLICRRFGSSLRPIARTLHPLLASKIIEAQRSPLKNKRFYAGKRMDLKY
LNQKEAIAVDQELFNDYKFSVDQLMELAGLSCAHAVAKCFPAEKHPRILV
CCGPGNNGGDGLVAARHLALMGYTPTIYYPKPTAKPLFENLSHQCQQMDI
CDVKECPSVESAARDYDLILDALFGFSFKPPVRADFVAVVELMQQTKLPI
ASVDIPSGWDVEKGKLTECDVEPALLISLTAPKLCARQFRGEHHYLGGRF
VPPALQRKYELNLPVYPGNELCVKL*

FI07335.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:53:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19489-PA 229 GF19489-PA 2..229 48..275 1033 80.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:53:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18945-PA 275 GG18945-PA 1..275 1..275 1357 92.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:53:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12525-PA 233 GH12525-PA 2..229 48..275 1045 82.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG2974-PB 230 CG2974-PB 1..230 46..275 1230 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11178-PA 229 GI11178-PA 2..229 48..275 1013 80.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:53:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16587-PA 226 GL16587-PA 2..226 48..275 889 72.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:53:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15549-PA 226 GA15549-PA 2..226 48..275 892 73.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:53:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11335-PA 230 GM11335-PA 1..230 46..275 1226 99.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:53:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24551-PA 128 GD24551-PA 1..128 148..275 659 97.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:53:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19543-PA 246 GJ19543-PA 19..246 48..275 1048 82.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:53:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25285-PA 260 GK25285-PA 37..257 37..250 877 73 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:53:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15417-PA 278 GE15417-PA 1..278 1..275 1317 90.3 Plus

FI07335.hyp Sequence

Translation from 107 to 934

> FI07335.hyp
MSLICRRFGSSLRPIARTLHPLLASKIIEAQRSPLKNKRFYAGKRMDLKY
LNQKEAIAVDQELFNDYKFSVDQLMELAGLSCAHAVAKCFPAEKHPRILV
CCGPGNNGGDGLVAARHLALMGYTPTIYYPKPTAKPLFENLSHQCQQMDI
CDVKECPSVESAARDYDLILDALFGFSFKPPVRADFVAVVELMQQTKLPI
ASVDIPSGWDVEKGKLTECDVEPALLISLTAPKLCARQFRGEHHYLGGRF
VPPALQRKYELNLPVYPGNELCVKL*

FI07335.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:31:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG2974-PB 230 CG2974-PB 1..230 46..275 1230 100 Plus