Clone FI07537 Report

Search the DGRC for FI07537

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:75
Well:37
Vector:pFlc-1
Associated Gene/TranscriptCG7378-RA
Protein status:FI07537.pep: gold
Sequenced Size:1205

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7378 2008-12-18 5.12 accounting

Clone Sequence Records

FI07537.complete Sequence

1205 bp assembled on 2008-11-04

GenBank Submission: BT050513.1

> FI07537.complete
GAGTCGCAAAAAAGTGCCCGTCGCCAGAACGCTGAAAAAACAGCAAACAA
TTGAGATAAATAAATAGACTCGAGATAGAAATAGTGATAGAGTGACAAGA
AGCAGCCAAAAGCGAGAGCTGCCACAAAAATCGAATTTTTTAAGGCAAAA
ACATCAAGGAATTCGCCGAGAGGATAACGAAAGCGCTGCACCGCAAACGT
GCGACCCCCTCCATCAGTCCATCAAACCATCAGTCCATCCAGCCAACTAT
CCCCATCCACAAAATCCAGATATCCGCGAATCCAGGAGCCAACGGTGACG
AAAGCAGCAGGGGCAGGACTCGCACACAGCCGAAACAACACAACAAACCC
AAAACACACACTCCACAAAGATGTCATGGAGATATGCGTCGCCCAGCCGC
TTGGAGACCTCCGAACAGACCACAGGCCGCCAGCTGCAGCGAGTCCTGCA
CTACTCGATGGCTCCTAGCCGGGCTCTTCCAGGACTAAGACGCGCCGAGT
GCGCCATCCATGACGTTGACTGTGATGAGGTCTATCCGGGCATCTACATT
GGTGATGCTGCGGCGGCCAAAAACAAAACGTATCTGAGATTGATGGGCAT
CACCCACGTTCTGAACGCGGCCGAGGGATGTCGGTATGGTCAGGTGGACA
CTGGACACAGCTACTACCGGGATATGCCCAGCATCAGGTACATGGGCTTC
CCCATGGTCGATGCCCCAACGACAGACATCTCGCGCTACTTCTACGTGGC
CTCCAAGTTCATCGACAGCGCCATCAGCAGCGGCGGCAAGATCCTGGTCC
ACTGCCTGGTGGGCATGTCGCGATCGGCCACCTGTGTGCTGGCCTACCTG
ATGATCTGCCGGAAGATGTCGGCGGTGGACGCGATACGCACGGTGCGGAT
GAGGCGCGATATCCGGCCGAATGATGGATTCCTGCAGCAACTGGCCGACT
TGGACATGGAGCTCAAGCGCAAGAACCTGTATCCCTACTAGTACGATTTT
TGTGGGACTTGACGGGGAGCCTAAGAGACAACCAAAGATCCAGGGAGAGT
GTAAACGGGGGGCAATGGCATGGATCTTGTAGGGGATCCGGCAACTAACC
AAATGAAAAATGAAAAAGATACAAGATAAAAGATTACAATTATGAAATGA
AAATCGAAAAATGAAAAATGAAAAATCGTTGTTCTAAACAAAAAAAAAAA
AAAAA

FI07537.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG7378.b 1951 CG7378.b 455..1261 388..1194 4035 100 Plus
CG7378.c 3812 CG7378.c 455..1261 388..1194 4035 100 Plus
CG7378.d 2027 CG7378.d 455..1261 388..1194 4035 100 Plus
CG7378.b 1951 CG7378.b 9..395 2..388 1935 100 Plus
CG7378.c 3812 CG7378.c 9..395 2..388 1935 100 Plus
CG7378.d 2027 CG7378.d 9..395 2..388 1935 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18797976..18798373 785..1189 1855 97.8 Plus
chrX 22417052 chrX 18789841..18790076 153..388 1165 99.6 Plus
chrX 22417052 chrX 18796602..18796772 388..558 855 100 Plus
chrX 22417052 chrX 18789527..18789685 2..159 730 98.7 Plus
chrX 22417052 chrX 18796835..18796965 559..689 655 100 Plus
chrX 22417052 chrX 18797370..18797474 686..790 510 99 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG7378-RA 621 CG7378-PA 1..621 371..991 3105 100 Plus
CG7378-RB 681 CG7378-PB 78..681 388..991 3020 100 Plus
CG7378-RC 708 CG7378-PC 403..708 686..991 1530 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:46 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG7378-RA 1189 CG7378-RA 2..1189 2..1189 5940 100 Plus
CG7378-RB 2020 CG7378-RB 448..1249 388..1189 4010 100 Plus
CG7378-RC 3832 CG7378-RC 773..1276 686..1189 2520 100 Plus
CG7378-RB 2020 CG7378-RB 2..388 2..388 1935 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG7378-PA 206 CG7378-PA 1..206 371..988 1080 100 Plus
CG7378-PB 226 CG7378-PB 25..226 383..988 1050 99.5 Plus
CG7378-PC 235 CG7378-PC 25..235 383..988 1030 95.3 Plus
Mkp3-PA 241 CG14080-PA 47..187 527..967 206 34.2 Plus
Mkp3-PD 411 CG14080-PD 217..357 527..967 206 34.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:16:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18908883..18909292 785..1194 2050 100 Plus
X 23542271 X 18900725..18900960 153..388 1180 100 Plus
X 23542271 X 18907498..18907668 388..558 855 100 Plus
X 23542271 X 18900411..18900568 2..159 790 100 Plus
X 23542271 X 18907731..18907861 559..689 655 100 Plus
X 23542271 X 18908275..18908379 686..790 510 99 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:29:58
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18916981..18917390 785..1194 2050 100 Plus
X 23527363 X 18908823..18909058 153..388 1180 100 Plus
X 23527363 X 18915596..18915766 388..558 855 100 Plus
X 23527363 X 18908509..18908666 2..159 790 100 Plus
X 23527363 X 18915829..18915959 559..689 655 100 Plus
X 23527363 X 18916373..18916477 686..790 510 99 Plus
Blast to na_te.dros performed on 2014-11-27 07:16:58 has no hits.

FI07537.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 09:48:06 Download gff for FI07537.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18797977..18798373 786..1189 97   Plus
chrX 18797372..18797469 688..785 100 -> Plus
chrX 18796835..18796963 559..687 100 -> Plus
chrX 18796603..18796772 389..558 100 -> Plus
chrX 18789948..18790076 260..388 100 -> Plus
chrX 18789847..18789894 159..206 97 == Plus
chrX 18789526..18789684 1..158 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:55:52 Download gff for FI07537.complete
Subject Subject Range Query Range Percent Splice Strand
CG7378-RA 1..621 371..991 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:17:43 Download gff for FI07537.complete
Subject Subject Range Query Range Percent Splice Strand
CG7378-RA 1..621 371..991 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:07:11 Download gff for FI07537.complete
Subject Subject Range Query Range Percent Splice Strand
CG7378-RA 1..621 371..991 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:48:06 Download gff for FI07537.complete
Subject Subject Range Query Range Percent Splice Strand
CG7378-RA 1..621 371..991 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:58:32 Download gff for FI07537.complete
Subject Subject Range Query Range Percent Splice Strand
CG7378-RA 2..1189 2..1189 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:17:43 Download gff for FI07537.complete
Subject Subject Range Query Range Percent Splice Strand
CG7378-RA 2..1189 2..1189 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:07:11 Download gff for FI07537.complete
Subject Subject Range Query Range Percent Splice Strand
CG7378-RA 2..1189 2..1189 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 14:09:59 Download gff for FI07537.complete
Subject Subject Range Query Range Percent Splice Strand
CG7378-RA 2..1189 2..1189 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:48:06 Download gff for FI07537.complete
Subject Subject Range Query Range Percent Splice Strand
CG7378-RA 2..1189 2..1189 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:48:06 Download gff for FI07537.complete
Subject Subject Range Query Range Percent Splice Strand
X 18908884..18909287 786..1189 100   Plus
X 18908277..18908374 688..785 100 -> Plus
X 18907731..18907859 559..687 100 -> Plus
X 18907499..18907668 389..558 100 -> Plus
X 18900731..18900960 159..388 100 -> Plus
X 18900410..18900567 1..158 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:07:11 Download gff for FI07537.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18802917..18803320 786..1189 100   Plus
arm_X 18802310..18802407 688..785 100 -> Plus
arm_X 18801764..18801892 559..687 100 -> Plus
arm_X 18801532..18801701 389..558 100 -> Plus
arm_X 18794764..18794993 159..388 100 -> Plus
arm_X 18794443..18794600 1..158 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:48:51 Download gff for FI07537.complete
Subject Subject Range Query Range Percent Splice Strand
X 18916982..18917385 786..1189 100   Plus
X 18916375..18916472 688..785 100 -> Plus
X 18915829..18915957 559..687 100 -> Plus
X 18915597..18915766 389..558 100 -> Plus
X 18908829..18909058 159..388 100 -> Plus
X 18908508..18908665 1..158 99 -> Plus

FI07537.pep Sequence

Translation from 370 to 990

> FI07537.pep
MSWRYASPSRLETSEQTTGRQLQRVLHYSMAPSRALPGLRRAECAIHDVD
CDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYR
DMPSIRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMS
RSATCVLAYLMICRKMSAVDAIRTVRMRRDIRPNDGFLQQLADLDMELKR
KNLYPY*

FI07537.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:53:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19249-PA 226 GF19249-PA 1..226 1..206 1065 90.7 Plus
Dana\GF10970-PA 443 GF10970-PA 6..140 52..196 213 31.5 Plus
Dana\GF10784-PA 461 GF10784-PA 222..362 53..199 212 34.9 Plus
Dana\GF20412-PA 374 GF20412-PA 33..169 49..191 194 32.4 Plus
Dana\GF16206-PA 225 GF16206-PA 39..186 55..202 187 34.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:53:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19201-PA 206 GG19201-PA 1..206 1..206 1096 99.5 Plus
Dere\GG13428-PA 411 GG13428-PA 217..357 53..199 215 34.2 Plus
Dere\GG13761-PA 443 GG13761-PA 6..140 52..196 215 32.2 Plus
Dere\GG23159-PA 486 GG23159-PA 117..274 37..200 195 30.6 Plus
Dere\GG19239-PA 385 GG19239-PA 35..171 49..191 181 32.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:53:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24728-PA 206 GH24728-PA 1..206 1..206 1085 97.6 Plus
Dgri\GH16949-PA 425 GH16949-PA 231..370 53..199 229 35.1 Plus
Dgri\GH12630-PA 385 GH12630-PA 61..200 53..199 228 35.1 Plus
Dgri\GH16683-PA 333 GH16683-PA 6..140 52..196 210 31.5 Plus
Dgri\GH18324-PA 487 GH18324-PA 87..237 45..203 201 30.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG7378-PA 206 CG7378-PA 1..206 1..206 1080 100 Plus
CG7378-PB 226 CG7378-PB 25..226 5..206 1050 99.5 Plus
CG7378-PC 235 CG7378-PC 25..235 5..206 1030 95.3 Plus
Mkp3-PA 241 CG14080-PA 47..187 53..199 206 34.2 Plus
Mkp3-PD 411 CG14080-PD 217..357 53..199 206 34.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:53:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14883-PA 226 GI14883-PA 1..226 1..206 1040 88.1 Plus
Dmoj\GI11809-PA 419 GI11809-PA 225..364 53..199 230 33.8 Plus
Dmoj\GI11369-PA 333 GI11369-PA 6..140 52..196 215 32.2 Plus
Dmoj\GI24889-PA 499 GI24889-PA 368..493 58..191 178 35.3 Plus
Dmoj\GI23305-PA 455 GI23305-PA 80..215 45..188 173 30.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10070-PA 80 GL10070-PA 2..78 64..140 400 96.1 Plus
Dper\GL15648-PA 83 GL15648-PA 27..83 7..63 303 98.2 Plus
Dper\GL20790-PA 471 GL20790-PA 6..140 52..196 212 31.5 Plus
Dper\GL20791-PA 305 GL20791-PA 7..139 53..195 203 32.6 Plus
Dper\GL21927-PA 410 GL21927-PA 216..348 53..191 201 34.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20307-PA 206 GA20307-PA 1..206 1..206 1093 98.5 Plus
Dpse\GA10063-PA 598 GA10063-PA 6..140 52..196 213 31.5 Plus
Dpse\GA12750-PA 410 GA12750-PA 216..348 53..191 201 34.5 Plus
Dpse\GA20632-PA 489 GA20632-PA 126..273 45..200 196 30 Plus
Dpse\GA12826-PA 380 GA12826-PA 29..165 49..191 186 32.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22933-PA 214 GM22933-PA 1..214 1..206 1071 95.3 Plus
Dsec\GM14895-PA 411 GM14895-PA 217..357 53..199 217 34.2 Plus
Dsec\GM24587-PA 440 GM24587-PA 6..140 52..196 215 32.2 Plus
Dsec\GM23703-PA 478 GM23703-PA 115..272 37..200 194 30.6 Plus
Dsec\GM22974-PA 388 GM22974-PA 37..173 49..191 184 33.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17418-PA 206 GD17418-PA 1..206 1..206 1099 100 Plus
Dsim\GD12305-PA 411 GD12305-PA 217..357 53..199 217 34.2 Plus
Dsim\GD12655-PA 443 GD12655-PA 6..140 52..196 214 32.2 Plus
Dsim\GD18513-PA 482 GD18513-PA 115..272 37..200 194 30.6 Plus
Dsim\GD17377-PA 233 GD17377-PA 61..191 63..199 170 34.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15313-PA 226 GJ15313-PA 1..226 1..206 1045 88.5 Plus
Dvir\GJ13512-PA 417 GJ13512-PA 223..362 53..199 232 34.5 Plus
Dvir\GJ11624-PA 465 GJ11624-PA 6..140 52..196 208 31.5 Plus
Dvir\GJ24161-PA 513 GJ24161-PA 125..275 45..203 195 29.4 Plus
Dvir\GJ15922-PA 374 GJ15922-PA 28..164 49..191 179 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25841-PA 206 GK25841-PA 1..206 1..206 1077 96.1 Plus
Dwil\GK12504-PA 432 GK12504-PA 237..378 53..200 221 34.4 Plus
Dwil\GK17106-PA 458 GK17106-PA 6..140 52..196 212 31.5 Plus
Dwil\GK14377-PA 529 GK14377-PA 119..264 45..198 189 30.4 Plus
Dwil\GK25725-PA 385 GK25725-PA 41..177 49..191 183 32.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:54:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17764-PA 206 GE17764-PA 1..206 1..206 1099 100 Plus
Dyak\GE22784-PA 279 GE22784-PA 85..225 53..199 215 34.2 Plus
Dyak\GE22525-PA 411 GE22525-PA 217..357 53..199 215 34.2 Plus
Dyak\GE20058-PA 443 GE20058-PA 6..140 52..196 215 32.2 Plus
Dyak\GE25849-PA 479 GE25849-PA 115..272 37..200 197 30.6 Plus

FI07537.hyp Sequence

Translation from 370 to 990

> FI07537.hyp
MSWRYASPSRLETSEQTTGRQLQRVLHYSMAPSRALPGLRRAECAIHDVD
CDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYR
DMPSIRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMS
RSATCVLAYLMICRKMSAVDAIRTVRMRRDIRPNDGFLQQLADLDMELKR
KNLYPY*

FI07537.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG7378-PA 206 CG7378-PA 1..206 1..206 1080 100 Plus
CG7378-PB 226 CG7378-PB 25..226 5..206 1050 99.5 Plus
CG7378-PC 235 CG7378-PC 25..235 5..206 1030 95.3 Plus
Mkp3-PA 241 CG14080-PA 47..187 53..199 206 34.2 Plus
Mkp3-PD 411 CG14080-PD 217..357 53..199 206 34.2 Plus