Clone FI08004 Report

Search the DGRC for FI08004

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:4
Vector:pOTB7
Associated Gene/TranscriptNs1-RA
Protein status:FI08004.pep: gold
Sequenced Size:2026

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3983 2008-12-18 5.12 accounting

Clone Sequence Records

FI08004.complete Sequence

2026 bp assembled on 2008-11-06

GenBank Submission: BT050580.1

> FI08004.complete
CTTCGCAGAGGGTTCACAAAAACCAAATTACATCACACTGCCAGTCTGGC
AACACTGGCAGTGTTGGCTAGCACGCCACAACAAGTGGCCACGCTTCGTG
GTGACTGACAAAAAGTCAAGAAGAAGACTATTTTCACGTGTTCTTGTTTT
AAGTCGGTTTTGATTCCGGTTATCCTCGTGTAAAATGGCTTTAAAAAGGT
TGAAGACCAAGAAATCCAAGAGGCTCACCGGTCGCTTGAAGCACAAGATC
GAAAAGAAGGTGCGGGACCACAACAAAAAGGAACGTCGCGCAGCCAAGAA
GAATCCGAAGAAGGGTAGCAAGAAACAGAAGCTCATCCAGATCCCGAACA
TCTGTCCCTTCAAGGATGACATCCTCAAGGAGGTGGAGGAGGCCAAGCAA
CGTCAGGAGGCCGAACGTTTGGCTCGCCGCGAAGCCTTTAAGGCGGAACG
CGAACAGAACAAGTTCAAGACGCTGGAGTCCATGGTCGAGGATGCAGACA
TGCGGAGCACCGTGCACGGAATAATGCACGAAAACGATGCCCAGGATCAG
GACGAAAAGAAGTACAAGAACGCCGTGACCAAAGAGCAGTCATTGAAGCA
GTACTTCAAGGAATTCCGCAAGGTGATAGAAAATGCCGACGTTGTCCTGG
AGGTGGTTGATGCACGTGACCCCCTGGGAACCCGCTGCAATGAAGTTGAG
CGCGCCGTTCGCGGTGCTCCGGGCAACAAGCGACTGGTCCTGGTGCTCAA
CAAAGCCGACCTGGTGCCGCGAGAGAATCTGAACAACTGGATCAAGTACT
TCCGTCGCAGCGGACCTGTCACCGCCTTCAAGGCTTCCACACAGGATCAG
GCCAACCGGCTGGGACGCCGCAAACTCCGCGAAATGAAAACCGAGAAGGC
TATGCAGGGTTCTGTCTGTATTGGCGCTGAGTTGCTTATGTCCATGCTGG
GCAACTACTGCCGCAACAAGGGCATCAAAACCTCGATTCGCGTTGGCGTC
GTTGGAATTCCCAATGTAGGCAAGAGCTCCATCATAAACTCGTTGACCCG
CGGCCGGTCCTGCATGGTGGGCAGCACGCCAGGAGTGACCAAGTCAATGC
AAGAAGTAGAACTGGATTCAAAAATCAAACTGATCGATTGTCCTGGAATC
GTATTTACCAGCGGAGGTGAAAATTCGCATGCAGTTCTGAAGAATGCTCA
GCGTGTGGGCGATGTAAAGGATCCTTTCACCATTGCCGAGAGCGTATTGA
AGCGTGCCAGCAAGGAATACTTCTGCACGATGTACGATATTACAAACTAC
GACACATTTGAAGAATTCTTCGCCAAAAAGGCAGCCAGAATGGGCAAATT
TCTAAAGAAGGGAGTTCCAGATGTTGTGGCTGCCGCAAGAAGCGTGCTCA
ACGATTGGAACACGGGCAAAATCAAATACTGCACACAGCCTCCGGAAGTT
CAAGAAGGACAAAGTGTGCATATAAGTGCCTCGATAGTACACTCAGAGGC
TCGCGAATTTGATGTGGAGAACTTTGAGTCCATGGAGACGGAAATCTTAG
AGCATTGCGCCGTGAAAACGGATGACATTATGGAGATAACGTCTACGGGG
CCTTTAGAGATTCGACAGCCGCGTGAGGAAGCCGAACCTGCAGATAAAAT
AACTGCCAGTTTGGTAATAGACGAGAAGGAAAAGCCCGCAAAGGGTCGCA
AACGAAAACTGGATGAGGAAAAGGAGAAGGTTGATCCCAGTCTACTCCTA
GAAGAAAACCAATCCCTGAATAAAGGCATAAAGCAGATGCAAAAGCTAAA
AAAGAAACAGAATGTTCGCAACGAGAAGAAAATATCCAAAATTACAGACG
TTCTGGATAGCTTTAGCTTAGGTCCATCCTCGTCCAAGGCAGAAAAATAC
GATTTTGATGAGGACTATGTGATTGAATAAATTCTGCCTTAGTTTTAATA
ATTAAATCTGTAGATAGTACACTATAATATAGAAAGGTGTAATGTCTCTG
AAAAACTAAAAAAAAAAAAAAAAAAA

FI08004.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:13:12
Subject Length Description Subject Range Query Range Score Percent Strand
ns1-RA 2043 ns1-RA 1..2009 1..2009 9745 99 Plus
mRpS11.a 746 mRpS11.a 1..58 58..1 290 100 Minus
mRpS11-RA 861 mRpS11-RA 1..57 57..1 285 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:55:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12896097..12896984 1094..207 4350 99.3 Minus
chr3R 27901430 chr3R 12895312..12895723 1754..1343 2015 99.3 Minus
chr3R 27901430 chr3R 12894990..12895244 2007..1753 1275 100 Minus
chr3R 27901430 chr3R 12895785..12896035 1344..1094 1165 97.6 Minus
chr3R 27901430 chr3R 12897049..12897254 206..1 1015 99.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:55:46
Subject Length Description Subject Range Query Range Score Percent Strand
Ns1-RA 1746 CG3983-PA 1..1746 185..1930 8445 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:19:50 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:55:45
Subject Length Description Subject Range Query Range Score Percent Strand
Ns1-RA 1895 CG3983-RA 1..1895 113..2007 9175 98.9 Plus
mRpS11-RA 729 CG5184-RA 1..56 56..1 280 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:55:48
Subject Length Description Subject Range Query Range Score Percent Strand
Ns1-PA 581 CG3983-PA 20..581 242..1927 2558 100 Plus
Ns2-PA 674 CG6501-PA 161..565 461..1729 472 30.5 Plus
Ns3-PB 606 CG14788-PB 163..506 599..1456 291 26.7 Plus
Ns3-PA 606 CG14788-PA 163..506 599..1456 291 26.7 Plus
CG17141-PA 323 CG17141-PA 32..206 608..1153 158 27.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:55:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17071630..17072517 1094..207 4350 99.3 Minus
3R 32079331 3R 17070845..17071256 1754..1343 1970 98.5 Minus
3R 32079331 3R 17070521..17070777 2009..1753 1270 99.6 Minus
3R 32079331 3R 17071318..17071568 1344..1094 1180 98 Minus
3R 32079331 3R 17072582..17072787 206..1 1015 99.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16812461..16813348 1094..207 4350 99.3 Minus
3R 31820162 3R 16811676..16812087 1754..1343 1970 98.5 Minus
3R 31820162 3R 16811352..16811608 2009..1753 1270 99.6 Minus
3R 31820162 3R 16812149..16812399 1344..1094 1180 98 Minus
3R 31820162 3R 16813413..16813618 206..1 1015 99.5 Minus
Blast to na_te.dros performed on 2014-11-27 09:55:44 has no hits.

FI08004.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:32:19 Download gff for FI08004.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12897049..12897254 1..206 99   Minus
chr3R 12896099..12896984 207..1092 99 <- Minus
chr3R 12895786..12896036 1093..1343 97 <- Minus
chr3R 12895312..12895722 1344..1754 99 <- Minus
chr3R 12894990..12895242 1755..2007 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:57:05 Download gff for FI08004.complete
Subject Subject Range Query Range Percent Splice Strand
CG3983-RA 1..1746 185..1930 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:19:15 Download gff for FI08004.complete
Subject Subject Range Query Range Percent Splice Strand
ns1-RA 1..1746 185..1930 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:36:03 Download gff for FI08004.complete
Subject Subject Range Query Range Percent Splice Strand
Ns1-RA 1..1746 185..1930 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:32:19 Download gff for FI08004.complete
Subject Subject Range Query Range Percent Splice Strand
Ns1-RA 1..1746 185..1930 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 08:00:00 Download gff for FI08004.complete
Subject Subject Range Query Range Percent Splice Strand
CG3983-RA 1..2007 1..2007 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:19:15 Download gff for FI08004.complete
Subject Subject Range Query Range Percent Splice Strand
ns1-RA 1..2007 1..2007 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:36:03 Download gff for FI08004.complete
Subject Subject Range Query Range Percent Splice Strand
Ns1-RA 1..1895 113..2007 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-06 10:05:37 Download gff for FI08004.complete
Subject Subject Range Query Range Percent Splice Strand
CG3983-RB 1..2007 1..2007 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:32:19 Download gff for FI08004.complete
Subject Subject Range Query Range Percent Splice Strand
Ns1-RA 1..1895 113..2007 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:32:19 Download gff for FI08004.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17072582..17072787 1..206 99   Minus
3R 17071632..17072517 207..1092 99 <- Minus
3R 17071319..17071569 1093..1343 97 <- Minus
3R 17070845..17071255 1344..1754 98 <- Minus
3R 17070523..17070775 1755..2007 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:36:03 Download gff for FI08004.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12898304..12898509 1..206 99   Minus
arm_3R 12897354..12898239 207..1092 99 <- Minus
arm_3R 12897041..12897291 1093..1343 97 <- Minus
arm_3R 12896567..12896977 1344..1754 98 <- Minus
arm_3R 12896245..12896497 1755..2007 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:50:34 Download gff for FI08004.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16813413..16813618 1..206 99   Minus
3R 16812463..16813348 207..1092 99 <- Minus
3R 16812150..16812400 1093..1343 97 <- Minus
3R 16811676..16812086 1344..1754 98 <- Minus
3R 16811354..16811606 1755..2007 99 <- Minus

FI08004.pep Sequence

Translation from 184 to 1929

> FI08004.pep
MALKRLKTKKSKRLTGRLKHKIEKKVRDHNKKERRAAKKNPKKGSKKQKL
IQIPNICPFKDDILKEVEEAKQRQEAERLARREAFKAEREQNKFKTLESM
VEDADMRSTVHGIMHENDAQDQDEKKYKNAVTKEQSLKQYFKEFRKVIEN
ADVVLEVVDARDPLGTRCNEVERAVRGAPGNKRLVLVLNKADLVPRENLN
NWIKYFRRSGPVTAFKASTQDQANRLGRRKLREMKTEKAMQGSVCIGAEL
LMSMLGNYCRNKGIKTSIRVGVVGIPNVGKSSIINSLTRGRSCMVGSTPG
VTKSMQEVELDSKIKLIDCPGIVFTSGGENSHAVLKNAQRVGDVKDPFTI
AESVLKRASKEYFCTMYDITNYDTFEEFFAKKAARMGKFLKKGVPDVVAA
ARSVLNDWNTGKIKYCTQPPEVQEGQSVHISASIVHSEAREFDVENFESM
ETEILEHCAVKTDDIMEITSTGPLEIRQPREEAEPADKITASLVIDEKEK
PAKGRKRKLDEEKEKVDPSLLLEENQSLNKGIKQMQKLKKKQNVRNEKKI
SKITDVLDSFSLGPSSSKAEKYDFDEDYVIE*

FI08004.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17911-PA 581 GF17911-PA 1..581 1..581 2754 91.2 Plus
Dana\GF13248-PA 676 GF13248-PA 161..479 93..426 489 34.5 Plus
Dana\GF21278-PA 605 GF21278-PA 163..503 139..422 308 27.3 Plus
Dana\GF15352-PA 575 GF15352-PA 140..413 121..348 193 24.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:29:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16794-PA 581 GG16794-PA 1..581 1..581 3061 99.1 Plus
Dere\GG21043-PA 674 GG21043-PA 161..493 93..440 488 33.7 Plus
Dere\GG12698-PA 607 GG12698-PA 320..505 249..422 210 30.6 Plus
Dere\GG21249-PA 575 GG21249-PA 140..494 121..424 202 24.2 Plus
Dere\GG12698-PA 607 GG12698-PA 163..243 139..219 158 35.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18066-PA 581 GH18066-PA 1..581 1..581 2510 84.3 Plus
Dgri\GH20960-PA 682 GH20960-PA 161..479 93..426 484 35 Plus
Dgri\GH11875-PA 611 GH11875-PA 344..517 268..430 199 31.4 Plus
Dgri\GH10880-PA 570 GH10880-PA 166..412 141..348 198 27.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
Ns1-PA 581 CG3983-PA 1..581 1..581 2956 100 Plus
Ns2-PA 674 CG6501-PA 156..635 88..571 486 29.2 Plus
Ns3-PB 606 CG14788-PB 163..506 139..424 291 26.7 Plus
Ns3-PA 606 CG14788-PA 163..506 139..424 291 26.7 Plus
Ns4-PA 575 CG9320-PA 140..494 121..424 177 24.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23744-PA 583 GI23744-PA 1..583 1..581 2483 84.9 Plus
Dmoj\GI21297-PA 678 GI21297-PA 161..480 93..427 492 35.5 Plus
Dmoj\GI15663-PA 613 GI15663-PA 309..516 230..426 206 29.7 Plus
Dmoj\GI18253-PA 574 GI18253-PA 145..475 124..405 184 24.3 Plus
Dmoj\GI15663-PA 613 GI15663-PA 162..242 139..219 163 37 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21923-PA 583 GL21923-PA 1..583 1..581 2646 87.5 Plus
Dper\GL10621-PA 676 GL10621-PA 190..468 120..421 466 35 Plus
Dper\GL14378-PA 602 GL14378-PA 163..504 139..426 309 26.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26447-PA 583 GA26447-PA 1..583 1..581 2606 87.5 Plus
Dpse\GA19643-PA 676 GA19643-PA 190..468 120..421 466 35 Plus
Dpse\GA13246-PA 602 GA13246-PA 163..504 139..426 310 26.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15388-PA 581 GM15388-PA 1..581 1..581 3071 99.3 Plus
Dsec\GM19971-PA 674 GM19971-PA 161..493 93..440 484 33.4 Plus
Dsec\GM18974-PA 607 GM18974-PA 320..505 249..422 209 30.6 Plus
Dsec\GM23366-PA 575 GM23366-PA 140..413 121..348 203 25.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20254-PA 328 GD20254-PA 1..328 254..581 1731 98.8 Plus
Dsim\GD25465-PA 674 GD25465-PA 161..493 93..440 490 33.7 Plus
Dsim\GD24278-PA 575 GD24278-PA 140..413 121..348 203 25.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10591-PA 581 GJ10591-PA 1..581 1..581 2539 84.5 Plus
Dvir\GJ20899-PA 682 GJ20899-PA 161..479 93..426 492 34.8 Plus
Dvir\GJ19196-PA 611 GJ19196-PA 162..510 139..422 270 26.4 Plus
Dvir\GJ17511-PA 576 GJ17511-PA 166..501 141..426 194 24 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:29:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13906-PA 579 GK13906-PA 1..579 1..581 2613 86.2 Plus
Dwil\GK21401-PA 681 GK21401-PA 161..493 93..445 476 33.4 Plus
Dwil\GK10107-PA 610 GK10107-PA 163..509 139..426 310 27.4 Plus
Dwil\GK14912-PA 576 GK14912-PA 141..495 121..424 198 24.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:29:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26110-PA 581 GE26110-PA 1..581 1..581 3052 99 Plus
Dyak\GE13986-PA 674 GE13986-PA 161..493 93..440 490 33.7 Plus
Dyak\GE16528-PA 572 GE16528-PA 320..470 249..422 194 31.6 Plus
Dyak\GE12344-PA 575 GE12344-PA 140..522 121..453 194 23.4 Plus

FI08004.hyp Sequence

Translation from 184 to 1929

> FI08004.hyp
MALKRLKTKKSKRLTGRLKHKIEKKVRDHNKKERRAAKKNPKKGSKKQKL
IQIPNICPFKDDILKEVEEAKQRQEAERLARREAFKAEREQNKFKTLESM
VEDADMRSTVHGIMHENDAQDQDEKKYKNAVTKEQSLKQYFKEFRKVIEN
ADVVLEVVDARDPLGTRCNEVERAVRGAPGNKRLVLVLNKADLVPRENLN
NWIKYFRRSGPVTAFKASTQDQANRLGRRKLREMKTEKAMQGSVCIGAEL
LMSMLGNYCRNKGIKTSIRVGVVGIPNVGKSSIINSLTRGRSCMVGSTPG
VTKSMQEVELDSKIKLIDCPGIVFTSGGENSHAVLKNAQRVGDVKDPFTI
AESVLKRASKEYFCTMYDITNYDTFEEFFAKKAARMGKFLKKGVPDVVAA
ARSVLNDWNTGKIKYCTQPPEVQEGQSVHISASIVHSEAREFDVENFESM
ETEILEHCAVKTDDIMEITSTGPLEIRQPREEAEPADKITASLVIDEKEK
PAKGRKRKLDEEKEKVDPSLLLEENQSLNKGIKQMQKLKKKQNVRNEKKI
SKITDVLDSFSLGPSSSKAEKYDFDEDYVIE*

FI08004.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:37:51
Subject Length Description Subject Range Query Range Score Percent Strand
Ns1-PA 581 CG3983-PA 1..581 1..581 2956 100 Plus
Ns2-PA 674 CG6501-PA 156..635 88..571 486 29.2 Plus
Ns3-PB 606 CG14788-PB 163..506 139..424 291 26.7 Plus
Ns3-PA 606 CG14788-PA 163..506 139..424 291 26.7 Plus
Ns4-PA 575 CG9320-PA 140..494 121..424 177 24.2 Plus