Clone FI08008 Report

Search the DGRC for FI08008

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:8
Vector:pOTB7
Associated Gene/TranscripteIF3-S9-RA
Protein status:FI08008.pep: gold
Sequenced Size:2630

Clone Sequence Records

FI08008.complete Sequence

2630 bp assembled on 2009-03-09

GenBank Submission: BT072816.1

> FI08008.complete
AGCAAACATATGCAGTATAAATACAAATAAATCTAAGAAACAGTAAATTA
AAATATATGCATGTACATATGTATTTATAAATATTAATAAAAGTTACCCC
GCCGCGTTGTCAACGCAGTGAGTAGTTGGCAACACTAACCATTCACACAA
AACAGTGTTTCGCCCTGACTGGCAAATGCGGCATCTCGCTCTTCCTTTTT
CACTTTGTGCTTGTGTGTTTAATGACGGAAAATTGCAAATAGATCGCTGA
ATATGGCCAAGAAGAAAAGCGAGGAGCACTCCGGTACGGATGCGAACGAC
AGTGATTACCAGGAGGAGCCGAACTTTGACGATCCGCCCGGGTTCGTGGA
CAACATTAGTGATGAAGATCTGTTGGGCGACATGTTGGCCCAGCGCCCCT
CGGAGGCCGATGGCGTCGAGAGTGTGGTGGTAGTGGACAATATCCCAAAG
GTGGAGCCGGTGCGCCTGGAGAAGCTGAAGTTGGTCATCAACAAGCTGTT
TTCGAACTACGGAGAAATCGTCAATGTGGTCTATCCCGTCGACGAGGAGG
GCAAAACCAAGGGCTACGCCTTCATGGAGTACAAGCAGGCCAGACAGGCG
GAGGAAGCCGTCAAGAAGCTCAACAATCATCGCCTAGACAAAAACCACAC
CTTTGCCGTCAATCTCTTCACCGATTTCCAAAAGTACGAAAACATCCCCG
AGAAGTGGGAGCCGCCAACCGTGCAGACCTTCAAGGTGCAGAGCGATCTA
TACAACTTCATCAATGACCCGGACACTTATGACCAGTACTGCGTGGCAGC
GGAGACCGCTCCCAACTGCGTGCAGGTTGGTTTCTGGCAAAACGTATTGC
CCGAACCCTTTGAGCTGGAGACCCGCGAACGCTTCACCGACACCTTCGTC
AAGTGGTCGCCCCTGGGTACTTATGTAGTCACCTTCCACAAACCCGGCGT
GGCCATCTGGGGTGGCAGTAGCTTCCAGAAGATTCAGAAGTTCCCCCATC
CTGGTACCCAATTCGTTGAGTTTTCGCCCTGCGAGAATTACCTAGTTACT
TACGGACCGACACCCACGGGCCAAAAGATCATCATTTGGGACATTCGCAC
TGGAGCCGAGAAGCGTTCGTTTGTTGCCGATGGCATGTCGGTTCTTTCTA
TGTTCCGCTGGTCGCACGACGACAAGTTTGTGGCCCGCATGGGCGAGAAT
TCGATCCACATCTACGAGACACCCTCTTTCTATCTTCTGGACCTGAAGTC
CATTAAGATTCCCGGCATTCGTGGCTTCTCTTGGTCCCCCACAGACAACG
TGATTGCCTACTGGGTGGAGGAGCAGAACCAAATACCCGCCCGCGTTACC
CTGATGGAGATCCCCAAGAAGCGTGAGATCCGTAACAAGAACCTTTTCCA
TGTGGCCGATTGCAAGTTACATTGGCAAAAGTCCGGCGACTATCTGTGCG
TTAAGGTAGATCGTTACTCAAAGTTGAAGAAGGATAAGAAGGACCTGGAC
GTCAAGTTTCTGGGCATGTTCTACAACTTTGAGATCTTCCACATGCGCGA
GAAGGAGATTCCCGTCGACTCTGTGGAGATTCGTGAGCTTATTTTGGCCT
TTGCCTGGGAGCCCGTCGGCAACAAGTTCTCCATCATTCACGGCGAGACC
AACTCGTCGAATGTGAGCTTCTACGAGGTGAACAAGGGCGTTAAGCCCAG
CTTGGTGAAGCGTCTAGAAAAGAAGTCATGCACACATCTGTTCTGGTCGC
CACGCGGTCAGTTTATCGTAATGGCCAACCTCACCATGGGTACCTTCGAG
TTTGTGGACTCCACCAACGATTACATCATCACGGCATCGCCCGATCATTT
CCGCGCTTCCGAGGTCGAGTGGGATCCCACTGGACGCTACGTTGTGACTG
GTGTCTCGTCATGGAAGGTGAAGGAGGATACCGGCTTCAACATGTACACG
TTCCAGGGCCGCATCATCAAGCGTACCATTCTCAAGAACTTTGTGCAGTT
CTTGTGGCGCCCGCGTCCTCCCACCCTGCTTAGCGAGGAGAAGCAGAAGG
AGATCAAGAAGAACTTGAAGAAGTACTACGCTGCCTTCGAACAAAAGGAT
CGCCTGCGCCTTACCCGTGCCTCCAAGGAGCTGCTCGAGAAGCGCTCTCA
GCTGCGCGAGACCTTTATGGAGTACCGCAACAAGCGTATTGCCGAGTGGG
CGGAGCAGAAGAGTCGTCGCATCATGCTGCGAGGGCATGTGGACACAGAC
AACCTGGAAACTGACGAAGTGGATGAAGAAATTGTTGAATTTTTAGTCAA
GGAAGAAGTCACTCTGCTCGAGTAGACGACCCCCTCAACGCCACTCCAAC
GCTGTCGTCCCCTGCCTACTTCGAAGCGATCCTGTCGCCTCACATTTCGT
GTCCGGGACGCGTCTACGCCCTGGTTGATGCCAGGGCCCTAATCCATTAT
CCAATACAGTAGCACGCGTCTGCTTGCAAACAACTCTAAGCGGAACCTTT
GCCTATACATACAACATACGAACACACGAATTATAAGCCCAAAAGTAAAC
TTCAACTCAATCAGCAATTGCGAACATAACATCTAATTAAATGACCTTTC
TTGCGCAAAAAAAAAAAAAAAAAAAAAAAA

FI08008.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:25:58
Subject Length Description Subject Range Query Range Score Percent Strand
eIF3-S9-RA 2816 eIF3-S9-RA 1..2607 1..2607 12795 99.3 Plus
eIF3-S9-RB 2575 eIF3-S9-RB 118..2482 243..2607 11615 99.4 Plus
eIF3-S9.a 2549 eIF3-S9.a 216..2456 367..2607 10995 99.3 Plus
eIF3-S9-RB 2575 eIF3-S9-RB 1..117 1..117 570 99.1 Plus
eIF3-S9.a 2549 eIF3-S9.a 1..117 1..117 570 99.1 Plus
eIF3-S9.a 2549 eIF3-S9.a 118..216 243..341 495 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13424124..13425676 684..2236 7735 99.9 Plus
chr2R 21145070 chr2R 13425748..13426117 2237..2606 1835 99.7 Plus
chr2R 21145070 chr2R 13423267..13423633 1..367 1820 99.7 Plus
chr2R 21145070 chr2R 13423748..13424068 366..686 1605 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
eIF3-S9-RA 2073 CG4878-PA 1..2073 253..2325 10170 99.4 Plus
eIF3-S9-RB 2073 CG4878-PB 1..2073 253..2325 10170 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:19:53 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
eIF3-S9-RA 2565 CG4878-RA 1..2486 121..2606 12205 99.4 Plus
eIF3-S9-RB 2481 CG4878-RB 118..2481 243..2606 11610 99.4 Plus
eIF3-S9-RB 2481 CG4878-RB 1..117 1..117 570 99.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
eIF3-S9-PA 690 CG4878-PA 1..677 253..2283 3446 100 Plus
eIF3-S9-PB 690 CG4878-PB 1..677 253..2283 3446 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17537070..17538622 684..2236 7615 99.4 Plus
2R 25286936 2R 17538694..17539064 2237..2607 1825 99.5 Plus
2R 25286936 2R 17536213..17536579 1..367 1805 99.5 Plus
2R 25286936 2R 17536694..17537014 366..686 1575 99.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:42:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17538269..17539821 684..2236 7615 99.3 Plus
2R 25260384 2R 17539893..17540263 2237..2607 1825 99.4 Plus
2R 25260384 2R 17537412..17537778 1..367 1805 99.4 Plus
2R 25260384 2R 17537893..17538213 366..686 1575 99.3 Plus
Blast to na_te.dros performed on 2014-11-27 16:15:05 has no hits.

FI08008.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:14:52 Download gff for FI08008.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13425748..13426117 2237..2606 99   Plus
chr2R 13424124..13425676 684..2236 99 -> Plus
chr2R 13423750..13424065 368..683 100 -> Plus
chr2R 13423267..13423633 1..367 94 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:51:40 Download gff for FI08008.complete
Subject Subject Range Query Range Percent Splice Strand
eIF3-S9-RA 1..2073 253..2325 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:39:05 Download gff for FI08008.complete
Subject Subject Range Query Range Percent Splice Strand
eIF3-S9-RA 1..2073 253..2325 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:32:36 Download gff for FI08008.complete
Subject Subject Range Query Range Percent Splice Strand
eIF3-S9-RB 1..2073 253..2325 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:14:52 Download gff for FI08008.complete
Subject Subject Range Query Range Percent Splice Strand
eIF3-S9-RB 1..2073 253..2325 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-09 14:43:33 Download gff for FI08008.complete
Subject Subject Range Query Range Percent Splice Strand
eIF3-S9-RA 1..2606 1..2606 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:39:04 Download gff for FI08008.complete
Subject Subject Range Query Range Percent Splice Strand
eIF3-S9-RA 1..2606 1..2606 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:32:36 Download gff for FI08008.complete
Subject Subject Range Query Range Percent Splice Strand
eIF3-S9-RA 1..2486 121..2606 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:14:52 Download gff for FI08008.complete
Subject Subject Range Query Range Percent Splice Strand
eIF3-S9-RA 1..2486 121..2606 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:14:52 Download gff for FI08008.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17538694..17539063 2237..2606 99   Plus
2R 17537070..17538622 684..2236 99 -> Plus
2R 17536696..17537011 368..683 99 -> Plus
2R 17536213..17536579 1..367 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:32:36 Download gff for FI08008.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13426199..13426568 2237..2606 99   Plus
arm_2R 13424575..13426127 684..2236 99 -> Plus
arm_2R 13424201..13424516 368..683 99 -> Plus
arm_2R 13423718..13424084 1..367 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:13:05 Download gff for FI08008.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17539893..17540262 2237..2606 99   Plus
2R 17538269..17539821 684..2236 99 -> Plus
2R 17537895..17538210 368..683 99 -> Plus
2R 17537412..17537778 1..367 99 -> Plus

FI08008.pep Sequence

Translation from 252 to 2324

> FI08008.pep
MAKKKSEEHSGTDANDSDYQEEPNFDDPPGFVDNISDEDLLGDMLAQRPS
EADGVESVVVVDNIPKVEPVRLEKLKLVINKLFSNYGEIVNVVYPVDEEG
KTKGYAFMEYKQARQAEEAVKKLNNHRLDKNHTFAVNLFTDFQKYENIPE
KWEPPTVQTFKVQSDLYNFINDPDTYDQYCVAAETAPNCVQVGFWQNVLP
EPFELETRERFTDTFVKWSPLGTYVVTFHKPGVAIWGGSSFQKIQKFPHP
GTQFVEFSPCENYLVTYGPTPTGQKIIIWDIRTGAEKRSFVADGMSVLSM
FRWSHDDKFVARMGENSIHIYETPSFYLLDLKSIKIPGIRGFSWSPTDNV
IAYWVEEQNQIPARVTLMEIPKKREIRNKNLFHVADCKLHWQKSGDYLCV
KVDRYSKLKKDKKDLDVKFLGMFYNFEIFHMREKEIPVDSVEIRELILAF
AWEPVGNKFSIIHGETNSSNVSFYEVNKGVKPSLVKRLEKKSCTHLFWSP
RGQFIVMANLTMGTFEFVDSTNDYIITASPDHFRASEVEWDPTGRYVVTG
VSSWKVKEDTGFNMYTFQGRIIKRTILKNFVQFLWRPRPPTLLSEEKQKE
IKKNLKKYYAAFEQKDRLRLTRASKELLEKRSQLRETFMEYRNKRIAEWA
EQKSRRIMLRGHVDTDNLETDEVDEEIVEFLVKEEVTLLE*

FI08008.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 20:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11342-PA 686 GF11342-PA 1..686 1..690 3491 95.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 20:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21791-PA 690 GG21791-PA 1..690 1..690 3650 98.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 20:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20755-PA 690 GH20755-PA 1..690 1..690 3470 94.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:17:51
Subject Length Description Subject Range Query Range Score Percent Strand
eIF3-S9-PA 690 CG4878-PA 1..690 1..690 3667 100 Plus
eIF3-S9-PB 690 CG4878-PB 1..690 1..690 3667 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 20:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20840-PA 690 GI20840-PA 1..690 1..690 3497 95.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 20:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11461-PA 690 GL11461-PA 1..690 1..690 3421 94.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 20:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24735-PA 690 GA24735-PA 1..690 1..690 3421 94.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 20:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21793-PA 690 GM21793-PA 1..690 1..690 3660 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 20:18:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11284-PA 690 GD11284-PA 1..690 1..690 3671 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 20:18:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20575-PA 690 GJ20575-PA 1..690 1..690 3501 95.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 20:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21404-PA 690 GK21404-PA 1..690 1..690 3476 94.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 20:18:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11867-PA 690 GE11867-PA 1..690 1..690 3568 98 Plus

FI08008.hyp Sequence

Translation from 252 to 2324

> FI08008.hyp
MAKKKSEEHSGTDANDSDYQEEPNFDDPPGFVDNISDEDLLGDMLAQRPS
EADGVESVVVVDNIPKVEPVRLEKLKLVINKLFSNYGEIVNVVYPVDEEG
KTKGYAFMEYKQARQAEEAVKKLNNHRLDKNHTFAVNLFTDFQKYENIPE
KWEPPTVQTFKVQSDLYNFINDPDTYDQYCVAAETAPNCVQVGFWQNVLP
EPFELETRERFTDTFVKWSPLGTYVVTFHKPGVAIWGGSSFQKIQKFPHP
GTQFVEFSPCENYLVTYGPTPTGQKIIIWDIRTGAEKRSFVADGMSVLSM
FRWSHDDKFVARMGENSIHIYETPSFYLLDLKSIKIPGIRGFSWSPTDNV
IAYWVEEQNQIPARVTLMEIPKKREIRNKNLFHVADCKLHWQKSGDYLCV
KVDRYSKLKKDKKDLDVKFLGMFYNFEIFHMREKEIPVDSVEIRELILAF
AWEPVGNKFSIIHGETNSSNVSFYEVNKGVKPSLVKRLEKKSCTHLFWSP
RGQFIVMANLTMGTFEFVDSTNDYIITASPDHFRASEVEWDPTGRYVVTG
VSSWKVKEDTGFNMYTFQGRIIKRTILKNFVQFLWRPRPPTLLSEEKQKE
IKKNLKKYYAAFEQKDRLRLTRASKELLEKRSQLRETFMEYRNKRIAEWA
EQKSRRIMLRGHVDTDNLETDEVDEEIVEFLVKEEVTLLE*

FI08008.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
eIF3-S9-PA 690 CG4878-PA 1..690 1..690 3667 100 Plus
eIF3-S9-PB 690 CG4878-PB 1..690 1..690 3667 100 Plus