Clone FI08017 Report

Search the DGRC for FI08017

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:17
Vector:pOTB7
Associated Gene/TranscriptCG5111-RA
Protein status:FI08017.pep: gold
Sequenced Size:2025

Clone Sequence Records

FI08017.complete Sequence

2025 bp assembled on 2009-05-14

GenBank Submission: BT083446.1

> FI08017.complete
GTAACACTGAAAGAGCAGTGTCAGAGTTGAAAATGTTCGTCATAAATTTA
GAAATTATTTAGTTCGATTCGGGCACGACAGCACGAAACATGTCCCAGAT
AAACAATATATTCATTAAGCTGCGAGCTCGTCTGCGGGAGCGTGATATCA
AGTTGTGGGAGGAGCCCTACTACTTCGAGGAGGTGGGCAGCATCGAGTCG
GAGATGGACCGCCTGGCCAGGGACATCAGTGGCGAACTGGGCATCAGTGT
GTCGGACTGCAGAATTGCCTTGGGCGAATTGCAAGATGGTGCCTTGAGGA
AGCTGGCGGCTCGCCGAGAGTTCAATGACACCGGATTGGCCACGTTCAAT
GTGCGGTGTGTGGACAGCAAGGGTGGCACCGTGCAAATGCTGGAGATCAA
GTGTTCGCTGGGTGGACTGGGCTCGGATCTGCAAGCTGAGGTGGCCAAGA
AGTTGGATATCGTTGATTCCAGTCATGTGAAATGCATCTCCGGAGGACGC
ATCATCAATGGGCAGAAGACACTGGCCTCGCAGGGGCTCAAAACCAATCA
GCACCTCATGGTGGTTGTGGGTGGAACTAATGAAGGTCAGGAGTTGCACG
AACGTATCCAAAGGATTCGTGCGGACTTGGAGTTAGTTGCGGATGCAGAT
CGCTTTATGGAAATGGAGGATCAAGATGGACGTCCAATTTTCTTGCCACG
CGAGGAAAATCGATCCCTATTGATGGCCATGAGCATGTACGAAGTGGCCA
GAGTTGCCATGCATAAGGAGAACTTCGATGAGGCTCTACTCATCCTACTC
GAGGCCGATGAACTCTTCTCCCAATGTGACTCAAAGCTCCTGGAAGGAGT
GGATAACTATGCCTTAATCAATCTAGATATTGTTTGGTGCTATCTGCGCC
TGAAGAACATCACCCAACTGCCAGATGCACAGCGACGTTTGGATATTTGC
GAGAGGGGCTTTGTCAAGAGCTATGGCGAGCAGTTCATCCGATTGTTCTC
GATTAAGGGTCCAAGTAGCCCGGAACGAGCTTTGATCATGAGACTGCACC
TGCTCCAAGGTGTGCTCCTCTTTCACCAAAATCGCCGGGATGAGGCCTAC
GAAAAACTGGAGGTGGCGACAAAGGACTTGTATGAGGTCAAGATGAATGA
CACTGAGCTAAGCACTCTCGTTGAAATGGGCTATGAGGAATCGGATGCCA
GGTTGGCCTTGAGATCCTGTGCGGGCCAAGTGGATAGGGCCATTCAATAT
ATCCAGGAACGCAGCGAGAGAATCAGTGAGGAGCGAAAGAACTCGGCTGC
CGAGAGGCAAGTCAACCAAGAGATGATTTTCGCCGGTCAAGGAGGAGAAT
GGGTCAATCCACGCAGCATTATTAGGCTCATGGAAATGGGCTACGAAAGG
CGTTTGGTTGTGGAGGCTCTGAAGAGGACCAAAAATAATCTCGATCGCAG
TTTGGATCTACTGCAGCGTCATTCAGATGAACTTAGGGCCAATCTGCCGC
CCATTCCTCCTGTCGATGAATCGTTACTTACTACTCTACAGCACCTTGGA
TTTTCGGAGATTTCCGCTCGAGATGCTTTGGAAACTACGGGCAACAGTTT
CCATAAATCTCTGAAATTTCTATTGAAAAGTTTCCCCAACGAATCGGAAT
TACTTCATGTTATTGAAACCATGACAAAAGTTTTGGAGGTTCAAGAACCT
ACGAGCTCAACTAATGCGACTGCAAATAGCACCACCCCACTCGTAAACTT
ATCCAACAGCAAGGTGAACTTGCTCCAGACTGTCCTTAGCGAGGCCAAGT
CGGAGATTGAGTCCTACAATGCCTTCAAGAGATTCAACGAGAACCTCGCC
GAGAACAACAACCACTACTTAAACTTGCCCTTGGATCAGGAGGAGCAAAT
TCTGATCGAGTATAAACGTTTGCTCGAGGGCTAATAAGAAAAACAAAAAT
GATTTTTTAAAAATATTTGTAAATCAAAAAACAGGCAATAAATAAGTACG
TACAAATAAAAAAAAAAAAAAAAAA

FI08017.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG5111-RA 2005 CG5111-RA 1..2005 1..2007 9815 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:38:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21329387..21331391 1..2007 9835 99.5 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:38:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG5111-RA 1845 CG5111-PA 1..1845 90..1934 9135 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:00 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:38:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG5111-RA 2005 CG5111-RA 1..2005 1..2007 9805 99.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG5111-PA 614 CG5111-PA 1..614 90..1931 2830 100 Plus
CG15445-PH 618 CG15445-PH 1..617 90..1928 1259 46 Plus
CG15445-PG 618 CG15445-PG 1..617 90..1928 1259 46 Plus
CG15445-PF 618 CG15445-PF 1..617 90..1928 1259 46 Plus
CG15445-PE 618 CG15445-PE 1..617 90..1928 1259 46 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:38:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25506275..25508280 1..2008 9810 99.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:21:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25247106..25249111 1..2008 9820 99.3 Plus
Blast to na_te.dros performed on 2014-11-26 20:38:31 has no hits.

FI08017.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:42:57 Download gff for FI08017.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21329387..21331391 1..2007 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:53:55 Download gff for FI08017.complete
Subject Subject Range Query Range Percent Splice Strand
CG5111-RA 1..1845 90..1934 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:52:34 Download gff for FI08017.complete
Subject Subject Range Query Range Percent Splice Strand
CG5111-RA 1..1845 90..1934 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:19:17 Download gff for FI08017.complete
Subject Subject Range Query Range Percent Splice Strand
CG5111-RA 1..1845 90..1934 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:42:57 Download gff for FI08017.complete
Subject Subject Range Query Range Percent Splice Strand
CG5111-RA 1..1845 90..1934 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-15 08:56:46 Download gff for FI08017.complete
Subject Subject Range Query Range Percent Splice Strand
CG5111-RA 1..2005 1..2007 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:52:34 Download gff for FI08017.complete
Subject Subject Range Query Range Percent Splice Strand
CG5111-RA 1..2005 1..2007 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:19:17 Download gff for FI08017.complete
Subject Subject Range Query Range Percent Splice Strand
CG5111-RA 1..2005 1..2007 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:42:57 Download gff for FI08017.complete
Subject Subject Range Query Range Percent Splice Strand
CG5111-RA 1..2005 1..2007 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:42:57 Download gff for FI08017.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25506275..25508279 1..2007 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:19:17 Download gff for FI08017.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21331997..21334001 1..2007 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:43:23 Download gff for FI08017.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25247106..25249110 1..2007 99   Plus

FI08017.pep Sequence

Translation from 89 to 1933

> FI08017.pep
MSQINNIFIKLRARLRERDIKLWEEPYYFEEVGSIESEMDRLARDISGEL
GISVSDCRIALGELQDGALRKLAARREFNDTGLATFNVRCVDSKGGTVQM
LEIKCSLGGLGSDLQAEVAKKLDIVDSSHVKCISGGRIINGQKTLASQGL
KTNQHLMVVVGGTNEGQELHERIQRIRADLELVADADRFMEMEDQDGRPI
FLPREENRSLLMAMSMYEVARVAMHKENFDEALLILLEADELFSQCDSKL
LEGVDNYALINLDIVWCYLRLKNITQLPDAQRRLDICERGFVKSYGEQFI
RLFSIKGPSSPERALIMRLHLLQGVLLFHQNRRDEAYEKLEVATKDLYEV
KMNDTELSTLVEMGYEESDARLALRSCAGQVDRAIQYIQERSERISEERK
NSAAERQVNQEMIFAGQGGEWVNPRSIIRLMEMGYERRLVVEALKRTKNN
LDRSLDLLQRHSDELRANLPPIPPVDESLLTTLQHLGFSEISARDALETT
GNSFHKSLKFLLKSFPNESELLHVIETMTKVLEVQEPTSSTNATANSTTP
LVNLSNSKVNLLQTVLSEAKSEIESYNAFKRFNENLAENNNHYLNLPLDQ
EEQILIEYKRLLEG*

FI08017.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17272-PA 615 GF17272-PA 1..614 1..613 2264 72.3 Plus
Dana\GF21714-PA 612 GF21714-PA 1..611 1..613 1560 52 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11412-PA 614 GG11412-PA 1..613 1..613 2699 86 Plus
Dere\GG19709-PA 565 GG19709-PA 1..564 1..613 1158 42.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18980-PA 615 GH18980-PA 1..614 1..613 1767 55.9 Plus
Dgri\GH11840-PA 610 GH11840-PA 1..609 1..613 1580 53.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:41:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG5111-PA 614 CG5111-PA 1..614 1..614 3095 100 Plus
CG15445-PH 618 CG15445-PH 1..617 1..613 1367 46.5 Plus
CG15445-PG 618 CG15445-PG 1..617 1..613 1367 46.5 Plus
CG15445-PF 618 CG15445-PF 1..617 1..613 1367 46.5 Plus
CG15445-PE 618 CG15445-PE 1..617 1..613 1367 46.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22406-PA 584 GI22406-PA 1..583 1..613 1560 51 Plus
Dmoj\GI14315-PA 612 GI14315-PA 1..611 1..613 1479 53.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22144-PA 597 GL22144-PA 1..596 1..613 1834 58.8 Plus
Dper\GL16401-PA 611 GL16401-PA 1..610 1..613 1482 49 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18667-PA 597 GA18667-PA 1..596 1..613 1863 59.5 Plus
Dpse\GA13736-PA 611 GA13736-PA 1..610 1..613 1467 48.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10250-PA 614 GM10250-PA 1..614 1..614 2896 92.8 Plus
Dsec\GM23064-PA 579 GM23064-PA 1..578 1..613 1298 44.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21223-PA 614 GD21223-PA 1..614 1..614 2910 93.6 Plus
Dsim\GD17514-PA 530 GD17514-PA 1..530 1..524 1261 48.4 Plus
Dsim\GD24435-PA 207 GD24435-PA 15..206 421..613 298 36.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10966-PA 632 GJ10966-PA 1..631 1..613 1723 54 Plus
Dvir\GJ19373-PA 610 GJ19373-PA 1..609 1..613 1548 54.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:41:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12848-PA 626 GK12848-PA 1..625 1..613 1898 60.2 Plus
Dwil\GK10251-PA 621 GK10251-PA 1..620 1..613 1559 51.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23608-PA 614 GE23608-PA 1..613 1..613 2661 85.3 Plus
Dyak\GE17908-PA 579 GE17908-PA 1..577 1..612 1379 47.6 Plus

FI08017.hyp Sequence

Translation from 89 to 1933

> FI08017.hyp
MSQINNIFIKLRARLRERDIKLWEEPYYFEEVGSIESEMDRLARDISGEL
GISVSDCRIALGELQDGALRKLAARREFNDTGLATFNVRCVDSKGGTVQM
LEIKCSLGGLGSDLQAEVAKKLDIVDSSHVKCISGGRIINGQKTLASQGL
KTNQHLMVVVGGTNEGQELHERIQRIRADLELVADADRFMEMEDQDGRPI
FLPREENRSLLMAMSMYEVARVAMHKENFDEALLILLEADELFSQCDSKL
LEGVDNYALINLDIVWCYLRLKNITQLPDAQRRLDICERGFVKSYGEQFI
RLFSIKGPSSPERALIMRLHLLQGVLLFHQNRRDEAYEKLEVATKDLYEV
KMNDTELSTLVEMGYEESDARLALRSCAGQVDRAIQYIQERSERISEERK
NSAAERQVNQEMIFAGQGGEWVNPRSIIRLMEMGYERRLVVEALKRTKNN
LDRSLDLLQRHSDELRANLPPIPPVDESLLTTLQHLGFSEISARDALETT
GNSFHKSLKFLLKSFPNESELLHVIETMTKVLEVQEPTSSTNATANSTTP
LVNLSNSKVNLLQTVLSEAKSEIESYNAFKRFNENLAENNNHYLNLPLDQ
EEQILIEYKRLLEG*

FI08017.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG5111-PA 614 CG5111-PA 1..614 1..614 3095 100 Plus
CG15445-PH 618 CG15445-PH 1..617 1..613 1367 46.5 Plus
CG15445-PG 618 CG15445-PG 1..617 1..613 1367 46.5 Plus
CG15445-PF 618 CG15445-PF 1..617 1..613 1367 46.5 Plus
CG15445-PE 618 CG15445-PE 1..617 1..613 1367 46.5 Plus