Clone FI08260 Report

Search the DGRC for FI08260

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:82
Well:60
Vector:pOTB7
Associated Gene/TranscriptCG8851-RA
Protein status:FI08260.pep: gold
Sequenced Size:2143

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8851 2008-08-15 Release 5.9 accounting
CG8851 2008-12-18 5.12 accounting

Clone Sequence Records

FI08260.complete Sequence

2143 bp assembled on 2008-08-14

GenBank Submission: BT044396.1

> FI08260.complete
ATATTTTTGGGAATTGAATGTGTCACATAAGGTTTTTAAAAAAATTCTCT
GTTCGCCAAAAACAGTGCAAAAAATTACACAAGTGCAACATTAACCAAAT
AGGCTAAATTTTCGTAGATGTTAAAGCCATCCAGGCGACCATTAGCCAAC
AGACAACGATCACTTCGATTCCGTCCACAGAATCGCAAAGGAACATCATC
TAGTAACACCTCAATGGGACTGGACTTCGAGCTGGATGAGAAGAACGAAG
ATCAGGCAGATGAAAATGAAAAGAGTAGCTATGTCAGCCTCTCCAGGCCG
AGCTCCAAAGTACTAGATACGAGAAGTGCCAGTAGCTTGGACTTCGGGGA
CCACTGTAGTCCCAGTATAACAAAATTACCCAAGAACAGCAGGGAAGGTA
AGGAGGTCAGCCTAATCATGAGTGATGAAGAGCCGGAAGATTACAGAAAG
GGTCTGGGCTCGAAGAGGAGGTTGCCAGACTCGGAAGCCCTTGGCAGCAA
GCTAAAGGAGGAACTCTGCAAGTACAAGCAGGAGCTCAAGGACTACAACG
AAAGCACCAAGGATCTGGAGGAGAAGTACATGAAAATTAACTACGAGCTG
TGCGAAATGCAGCAGAAGCACGATCAGTTCGTGTCCAGCAGGAAGCAGGC
CCAGCAAATGGATCTGGGAAGTGAGCCCGATCCGGATGGATTTTATAGCT
CTGCCAGCAGTGTCACCTCGCAGACGACCATCAGACGAAAGAGCCCCCAA
ATCCTGCGCAGCAATACCAGTTTCATGACCGTTCTATCGGGCCAGAGTTC
CTGCGACGAAATCGATAGAAAGAAATACGCGTCCGAAAGGAGTACTCATC
AGCAGAATCACCATCGGCACAAGGACGATCTGCCATCACAGGTGAACAGC
GTTTTTGACAGCCGTATTGTGGAAACACTGGCGAACCGTCACGTGAAGCG
CAGGAAGAGATCCTTGGAGCAGGACGATCGGGAAAGGGAGCCAGCATCCT
TCAAGGATGTGTACAATGTGCTGAAGGATGTGATCAACACCTCACAGGAT
CAGAAGTACAAGCATGAACGGGATCGAGGTAGGGACAGAGACAGGGACAG
GGACTCTGGAGATATAAGCCAGCTCCTTACCACCATTAAGGGACTGAAGA
GCGAGCAGGTCCAGTTTCGAACTCTCATTCGGCAGCAGCAGGAGAGAATA
TCGGACTACCACACGCGGTGTGTGAAAGCCCAGGACATCATGAGCACCCA
GAAGCAGGAGATCGAGAAGCTGCACGTGAATAACAAGCAGTTGGAGTCGA
GCATCTACCATGACATAGACAGTCTGCGATCCAAGATAGACAACAAACTG
AAAAGTGTCTCCCATTTGCCGAAGATGATGCGAGACGAGCACTCCAAGTA
CGAGACGGTAATGCGGGAAAATTGTCTGCTGGCGGATAAACTTCATGCCC
TCCAACAGGAAGCCATGCAGCTGAAGGTCAAAATAGATGAACTGGGCCGT
CGAAAGTTGGTCACCATCAACCGGCTGAAGGCCGCCGAAAGGGATCTGAA
GATCTTTAAGAACTACAACTCGGCCTTGAAGACGGAGAAGCGGAAACTGA
CCCAGGAGCTGTCCACCATGAAGGATCAGCTGGAGCAGCTCCAGGCGAGC
AGCAAAAGGCAACTTTCCCGCCATCGCGAGCAGAGCGAAAAGCAGCGCAG
GGATCTGCAGAAGAAGATCTACGACCTCGAACTGAAGCTGAGTAGGAGCC
AAAACTCGACGTCCAGTTTGATCCAGGAACGGGATAGTCTGATAGCTGAG
CTCCAGACGCAACTCCACACCCTGGTCCACAACTTCGAGGTCTCGCAGAA
ACACATAAGGGTTCTCCGGCGGCACATCTACTCCATGACGAATCAGGGTG
GCACGGGCATCGTTGGCAGTGGGTCGGCTGGCATTGCCCACTTGACATCA
GGTGGTTCCCATCGACCCAGTCTGATCAGGATCAATCAGCTGCCCCAGGG
AACCAGCAACGGTCGATTTGCAGCCCCCCGAACTCTAAAGGCGACGATCT
AAACGGGGATCTGGACTGGACATTATCAGCCCTTATCAAGCCACCAATTA
TTTCACTCTAATGATTATGTAAACTCAAAAAAAAAAAAAAAAA

FI08260.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG8851-RA 2304 CG8851-RA 41..2111 1..2071 10310 99.8 Plus
CG8851.a 2224 CG8851.a 41..1448 1..1408 7025 99.9 Plus
CG8851.a 2224 CG8851.a 1447..2060 1458..2071 3040 99.6 Plus
nc_728.a 598 nc_728.a 1..598 2126..1529 2960 99.6 Minus
CG8851-RA 2304 CG8851-RA 2203..2264 2066..2127 295 98.3 Plus
CG8851.a 2224 CG8851.a 2152..2213 2066..2127 295 98.3 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 22:19:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3519840..3520887 1..1048 5225 99.9 Plus
chr2L 23010047 chr2L 3520943..3521969 1045..2071 4940 98.7 Plus
chr2L 23010047 chr2L 3522061..3522121 2066..2126 290 98.4 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:19:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG8851-RC 2172 CG8851-PC 237..2172 117..2052 9635 99.8 Plus
CG8851-RA 1935 CG8851-PA 1..1935 118..2052 9630 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:43 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:19:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG8851-RA 2275 CG8851-RA 41..2111 1..2071 10310 99.9 Plus
CG8851-RC 2390 CG8851-RC 272..2226 117..2071 9730 99.8 Plus
CG8851-RA 2275 CG8851-RA 2203..2263 2066..2126 290 98.4 Plus
CG8851-RC 2390 CG8851-RC 2318..2378 2066..2126 290 98.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:19:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG8851-PC 723 CG8851-PC 80..723 118..2049 3082 100 Plus
CG8851-PA 644 CG8851-PA 1..644 118..2049 3082 100 Plus
CG3213-PA 676 CG3213-PA 411..669 1114..1896 324 26.4 Plus
Cep135-PB 1065 CG17081-PB 393..837 499..1854 162 20.2 Plus
Cep135-PC 960 CG17081-PC 393..808 499..1779 160 20.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:18:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3520262..3521309 1..1048 5225 99.9 Plus
2L 23513712 2L 3521365..3522391 1045..2071 5105 99.8 Plus
2L 23513712 2L 3522483..3522544 2066..2127 295 98.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3520262..3521309 1..1048 5225 99.9 Plus
2L 23513712 2L 3521365..3522391 1045..2071 5105 99.8 Plus
2L 23513712 2L 3522483..3522544 2066..2127 295 98.3 Plus
Blast to na_te.dros performed on 2014-11-26 22:19:00 has no hits.

FI08260.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 00:49:40 Download gff for FI08260.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3522057..3522121 2064..2126 93   Plus
chr2L 3520946..3521961 1048..2063 98 -> Plus
chr2L 3519840..3520886 1..1047 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:58:25 Download gff for FI08260.complete
Subject Subject Range Query Range Percent Splice Strand
CG8851-RA 1..1935 118..2052 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:39 Download gff for FI08260.complete
Subject Subject Range Query Range Percent Splice Strand
CG8851-RA 1..1935 118..2052 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:44:06 Download gff for FI08260.complete
Subject Subject Range Query Range Percent Splice Strand
CG8851-RC 237..2172 117..2052 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:57 Download gff for FI08260.complete
Subject Subject Range Query Range Percent Splice Strand
CG8851-RA 1..1935 118..2052 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:49:40 Download gff for FI08260.complete
Subject Subject Range Query Range Percent Splice Strand
CG8851-RC 237..2172 117..2052 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:34:54 Download gff for FI08260.complete
Subject Subject Range Query Range Percent Splice Strand
CG8851-RA 1..2070 1..2071 99 <- Plus
CG8851-RA 2169..2223 2072..2126 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:39 Download gff for FI08260.complete
Subject Subject Range Query Range Percent Splice Strand
CG8851-RA 2169..2223 2072..2126 98   Plus
CG8851-RA 1..2070 1..2071 99 <- Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:44:06 Download gff for FI08260.complete
Subject Subject Range Query Range Percent Splice Strand
CG8851-RA 2209..2263 2072..2126 98   Plus
CG8851-RA 41..2110 1..2071 99 <- Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-14 11:28:57 Download gff for FI08260.complete
Subject Subject Range Query Range Percent Splice Strand
CG8851-RA 1..2070 1..2071 99 <- Plus
CG8851-RA 2169..2223 2072..2126 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:49:40 Download gff for FI08260.complete
Subject Subject Range Query Range Percent Splice Strand
CG8851-RA 2209..2263 2072..2126 98   Plus
CG8851-RA 41..2110 1..2071 99 <- Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 00:49:40 Download gff for FI08260.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3522489..3522543 2072..2126 98   Plus
2L 3521368..3522390 1048..2071 99 <- Plus
2L 3520262..3521308 1..1047 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:44:06 Download gff for FI08260.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3522489..3522543 2072..2126 98   Plus
arm_2L 3521368..3522390 1048..2071 99 <- Plus
arm_2L 3520262..3521308 1..1047 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:38:14 Download gff for FI08260.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3522489..3522543 2072..2126 98   Plus
2L 3521368..3522390 1048..2071 99 <- Plus
2L 3520262..3521308 1..1047 99 -> Plus

FI08260.pep Sequence

Translation from 117 to 2051

> FI08260.pep
MLKPSRRPLANRQRSLRFRPQNRKGTSSSNTSMGLDFELDEKNEDQADEN
EKSSYVSLSRPSSKVLDTRSASSLDFGDHCSPSITKLPKNSREGKEVSLI
MSDEEPEDYRKGLGSKRRLPDSEALGSKLKEELCKYKQELKDYNESTKDL
EEKYMKINYELCEMQQKHDQFVSSRKQAQQMDLGSEPDPDGFYSSASSVT
SQTTIRRKSPQILRSNTSFMTVLSGQSSCDEIDRKKYASERSTHQQNHHR
HKDDLPSQVNSVFDSRIVETLANRHVKRRKRSLEQDDREREPASFKDVYN
VLKDVINTSQDQKYKHERDRGRDRDRDRDSGDISQLLTTIKGLKSEQVQF
RTLIRQQQERISDYHTRCVKAQDIMSTQKQEIEKLHVNNKQLESSIYHDI
DSLRSKIDNKLKSVSHLPKMMRDEHSKYETVMRENCLLADKLHALQQEAM
QLKVKIDELGRRKLVTINRLKAAERDLKIFKNYNSALKTEKRKLTQELST
MKDQLEQLQASSKRQLSRHREQSEKQRRDLQKKIYDLELKLSRSQNSTSS
LIQERDSLIAELQTQLHTLVHNFEVSQKHIRVLRRHIYSMTNQGGTGIVG
SGSAGIAHLTSGGSHRPSLIRINQLPQGTSNGRFAAPRTLKATI*

FI08260.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 19:55:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15241-PA 677 GF15241-PA 1..677 1..644 2033 67.8 Plus
Dana\GF14666-PA 666 GF14666-PA 393..664 325..598 287 26.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 19:55:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24950-PA 646 GG24950-PA 1..646 1..644 2973 90.9 Plus
Dere\GG24430-PA 679 GG24430-PA 406..677 325..598 292 26.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 19:55:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13692-PA 534 GH13692-PA 46..503 103..591 1432 60.7 Plus
Dgri\GH13194-PA 674 GH13194-PA 404..667 327..593 293 28 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:55:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG8851-PC 723 CG8851-PC 80..723 1..644 3262 100 Plus
CG8851-PA 644 CG8851-PA 1..644 1..644 3262 100 Plus
CG3213-PA 676 CG3213-PA 403..669 325..593 342 26.8 Plus
zip-PH 1964 CG15792-PH 1125..1660 96..587 164 20 Plus
zip-PG 1971 CG15792-PG 1117..1652 96..587 164 20 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 19:55:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23811-PA 639 GI23811-PA 90..637 93..642 1534 59 Plus
Dmoj\GI17773-PA 678 GI17773-PA 408..671 327..593 301 28.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 19:55:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18660-PA 676 GL18660-PA 124..670 121..640 1461 61.1 Plus
Dper\GL19472-PA 620 GL19472-PA 347..618 325..598 277 26.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 19:55:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21367-PA 676 GA21367-PA 124..670 121..640 1460 61.1 Plus
Dpse\GA16698-PA 661 GA16698-PA 388..659 325..598 282 26.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 19:55:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18419-PA 614 GM18419-PA 1..614 33..644 2980 95.4 Plus
Dsec\GM18142-PA 312 GM18142-PA 39..310 325..598 277 26.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 19:55:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23239-PA 204 GD23239-PA 1..204 1..204 982 92.2 Plus
Dsim\GD22749-PA 676 GD22749-PA 403..669 325..593 286 26.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 19:55:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21047-PA 655 GJ21047-PA 27..653 31..642 1543 54.8 Plus
Dvir\GJ17597-PA 677 GJ17597-PA 407..670 327..593 296 28.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 19:55:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19067-PA 357 GK19067-PA 4..352 294..640 1267 69.3 Plus
Dwil\GK14671-PA 664 GK14671-PA 393..657 327..593 288 27 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 19:55:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18242-PA 718 GE18242-PA 80..718 1..644 2873 86.9 Plus
Dyak\GE14847-PA 677 GE14847-PA 404..675 325..598 290 26.3 Plus

FI08260.hyp Sequence

Translation from 117 to 2051

> FI08260.hyp
MLKPSRRPLANRQRSLRFRPQNRKGTSSSNTSMGLDFELDEKNEDQADEN
EKSSYVSLSRPSSKVLDTRSASSLDFGDHCSPSITKLPKNSREGKEVSLI
MSDEEPEDYRKGLGSKRRLPDSEALGSKLKEELCKYKQELKDYNESTKDL
EEKYMKINYELCEMQQKHDQFVSSRKQAQQMDLGSEPDPDGFYSSASSVT
SQTTIRRKSPQILRSNTSFMTVLSGQSSCDEIDRKKYASERSTHQQNHHR
HKDDLPSQVNSVFDSRIVETLANRHVKRRKRSLEQDDREREPASFKDVYN
VLKDVINTSQDQKYKHERDRGRDRDRDRDSGDISQLLTTIKGLKSEQVQF
RTLIRQQQERISDYHTRCVKAQDIMSTQKQEIEKLHVNNKQLESSIYHDI
DSLRSKIDNKLKSVSHLPKMMRDEHSKYETVMRENCLLADKLHALQQEAM
QLKVKIDELGRRKLVTINRLKAAERDLKIFKNYNSALKTEKRKLTQELST
MKDQLEQLQASSKRQLSRHREQSEKQRRDLQKKIYDLELKLSRSQNSTSS
LIQERDSLIAELQTQLHTLVHNFEVSQKHIRVLRRHIYSMTNQGGTGIVG
SGSAGIAHLTSGGSHRPSLIRINQLPQGTSNGRFAAPRTLKATI*

FI08260.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:41:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG8851-PC 723 CG8851-PC 80..723 1..644 3262 100 Plus
CG8851-PA 644 CG8851-PA 1..644 1..644 3262 100 Plus
CG3213-PA 676 CG3213-PA 403..669 325..593 342 26.8 Plus
zip-PH 1964 CG15792-PH 1125..1660 96..587 164 20 Plus
zip-PG 1971 CG15792-PG 1117..1652 96..587 164 20 Plus