Clone FI08407 Report

Search the DGRC for FI08407

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:84
Well:7
Vector:pOTB7
Associated Gene/TranscriptCG3123-RA
Protein status:FI08407.pep: gold
Sequenced Size:1987

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3123 2008-12-18 5.12 accounting

Clone Sequence Records

FI08407.complete Sequence

1987 bp assembled on 2008-11-07

GenBank Submission: BT050583.1

> FI08407.complete
TAATGAAGAGAAAGCGAGTTGCTAGTCGTTTGTTCAACATTTTCCTTTTG
GCGGTTCTGTGCTATCTAATATTGACTTCCCTTTCTGATCGGAATAAAAC
GATTAGTATACGCGAAGTGCCCCAGATCTACATCAATGAGGAAGATGAAC
TCTTTGTCAACACCACGGGATGTCGAATAAGTGCGACGAAACCACTTTCG
CTTTACGCCCTGTCCTTCATGGAGCCCATTGAACCCGTTTTATGTAGAAT
GGAGCAGCTGATGGTCGCCGAGACAATTGGAGACAGGAATTACTTGGTGC
GTAACATATCGCGGCATGGGATTCTCTCCTGGAGGCAAGTCTCCTGCATT
TATCGGGAATTTGTGAGGGTCGATGACGCACACAACAAGTACATATCCTT
GAAGTTTTTCAAGCTTACCGATCGAACGAGATACCTTGAGGTGGGTACTG
GTCTGCAACATATTCGCACTTGGTGCTGGGTAGACTTTGGCAGGATCATA
TTCCACGACGTTATGTACTTCCTGCCACCACTGCCTCAGGCTACGAACAG
ATCAACAGAACATCAGAAGAGAAAGCTGTCCGTGATGATCCTGGGAGTAG
ATTCTATCTCGCACATGCATTACATGCGTTACTTTCACCGCGTGGCCGAC
TTCATCGAGCACCTGCCCCACACCGAATTCTGGGGCTATAATCGCGTCGC
CTTGAACACCTATCCCAACTTGATCCCTCTGGTAAGCGGACTTAGTGTTT
CGGAGATGGAGGCGTCTTGCTACCATGACGAATTGAACTTTGACAAATGT
AACTTCTTGTGGAATGAATTCAAGAGGGCGGGATACAGCACCATCTTTGC
AGAGGACACGGATACCGCTGGGCTGTTTATCTACAGAAAGAGGGGCTTTC
AGAAGCAGCCCACCGATATTTACATGCGACCTCTGATGACTGAGATTGAA
TCTCATTCGCTCTACCGCACCACATTCGATTTAAAGTGCACGGGTCATCG
TCTCTATGGAGAGTTTTACTATGATTTCGTCTCCAAGCTGATTCCGCACA
TGGAACGTCAGTTATTTTTCTCATTTTTGTGGAATATGCATGGCATACAC
GACGTCTTTCCATATGCCAAGTTTGTGGATAAGGATTACCTGAGTATTTT
GACAAGGTTACACGAAAAGGGAGTGATGGAGAACACATTGATACTGTTTA
TGGGTGATCACGGCCTGAGATTTGATAAATTCGCCCGAACTGCTCCGGGA
CAACATGAAATGTCGCAGCCACTCTTGATCGCCATTTATCCCGAATGGCT
GAAAAGGAGATTTCCGCTCGCCATGTCGAATTTTGAACGAAACGCCAGAA
GTCTCATTACCACATTCGATCTGCACGAAACCCTCAAAGATGTGATCCAT
CTTGATCGGCTGACCGATGCCAATGTGAGGAATAGAACGCTTTATTTGAC
GAACGAGCGCGGAATCAGTCTGTTTTTACCCATTCCTCAGAATCGAAATT
GTAAAACCGCTGAGATAAAGCAACACTATTGCCTCTGCAACGAACTTAAA
TCGGTATCCACCCACGAAAGTGCCATTCAAGAGGCTGCCAGTTTCGCAGT
GGACAGGATCAACGAGCTCATCAAGCCATATCCTCAGTGTAGAGTTCTAA
GCCTACAATCGGTTCGCACTGCCTACCGCGCCAAAAGTAGTACCTACCGA
GGAAACTACAGGGTGTCCCAGGTTATGGTCCGCTTGAAAACGACGCCCGG
CGATGGAAACTTCGATGCCACCGTTCTCATAACAATGCTTAATGGCGAAA
AGACGGATATGAAGCTGGGAGGTCCTGTGACCAGGACAGACAGATACGCC
CATCAGGCGTACTGCGTTCAAAACTATCGCATTGAAATGTACTGCTATTG
CTTATGATCGACTAAGTATAAGTTTGTAAAAATAAATTTGATATTTTTTT
TAACAATGTTAAAAAAAAAAAAAAAAAAAAAAAAAAA

FI08407.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG3123-RA 1961 CG3123-RA 1..1961 1..1960 9610 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2823249..2825207 1960..1 9630 99.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG3123-RA 1905 CG3123-PA 1..1905 3..1907 9525 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:50 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG3123-RA 1961 CG3123-RA 1..1949 1..1950 9595 99.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG3123-PA 634 CG3123-PA 1..634 3..1904 3372 100 Plus
CG14731-PA 641 CG14731-PA 13..640 36..1901 1397 43.7 Plus
CG1428-PA 617 CG1428-PA 42..617 141..1904 998 38 Plus
CG16854-PC 677 CG16854-PC 29..675 39..1901 986 34.2 Plus
CG16854-PB 705 CG16854-PB 57..703 39..1901 986 34.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:46:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2823558..2825506 1950..1 9595 99.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2823545..2825506 1961..1 9615 99.4 Minus
Blast to na_te.dros performed on 2014-11-26 21:46:59 has no hits.

FI08407.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:43:36 Download gff for FI08407.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2823249..2825207 1..1960 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:58:36 Download gff for FI08407.complete
Subject Subject Range Query Range Percent Splice Strand
CG3123-RA 1..1905 3..1907 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:19:38 Download gff for FI08407.complete
Subject Subject Range Query Range Percent Splice Strand
CG3123-RA 1..1905 3..1907 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:37:39 Download gff for FI08407.complete
Subject Subject Range Query Range Percent Splice Strand
CG3123-RA 1..1905 3..1907 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:43:36 Download gff for FI08407.complete
Subject Subject Range Query Range Percent Splice Strand
CG3123-RA 1..1905 3..1907 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 08:00:30 Download gff for FI08407.complete
Subject Subject Range Query Range Percent Splice Strand
CG3123-RA 1..1942 1..1943 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:19:38 Download gff for FI08407.complete
Subject Subject Range Query Range Percent Splice Strand
CG3123-RA 1..1942 1..1943 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:37:39 Download gff for FI08407.complete
Subject Subject Range Query Range Percent Splice Strand
CG3123-RA 1..1942 1..1943 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-07 10:12:41 Download gff for FI08407.complete
Subject Subject Range Query Range Percent Splice Strand
CG3123-RA 1..1942 1..1943 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:43:36 Download gff for FI08407.complete
Subject Subject Range Query Range Percent Splice Strand
CG3123-RA 1..1942 1..1943 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:43:36 Download gff for FI08407.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2823583..2825506 1..1924 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:37:39 Download gff for FI08407.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2823583..2825506 1..1924 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:50:59 Download gff for FI08407.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2823583..2825506 1..1924 99   Minus

FI08407.pep Sequence

Translation from 2 to 1906

> FI08407.pep
MKRKRVASRLFNIFLLAVLCYLILTSLSDRNKTISIREVPQIYINEEDEL
FVNTTGCRISATKPLSLYALSFMEPIEPVLCRMEQLMVAETIGDRNYLVR
NISRHGILSWRQVSCIYREFVRVDDAHNKYISLKFFKLTDRTRYLEVGTG
LQHIRTWCWVDFGRIIFHDVMYFLPPLPQATNRSTEHQKRKLSVMILGVD
SISHMHYMRYFHRVADFIEHLPHTEFWGYNRVALNTYPNLIPLVSGLSVS
EMEASCYHDELNFDKCNFLWNEFKRAGYSTIFAEDTDTAGLFIYRKRGFQ
KQPTDIYMRPLMTEIESHSLYRTTFDLKCTGHRLYGEFYYDFVSKLIPHM
ERQLFFSFLWNMHGIHDVFPYAKFVDKDYLSILTRLHEKGVMENTLILFM
GDHGLRFDKFARTAPGQHEMSQPLLIAIYPEWLKRRFPLAMSNFERNARS
LITTFDLHETLKDVIHLDRLTDANVRNRTLYLTNERGISLFLPIPQNRNC
KTAEIKQHYCLCNELKSVSTHESAIQEAASFAVDRINELIKPYPQCRVLS
LQSVRTAYRAKSSTYRGNYRVSQVMVRLKTTPGDGNFDATVLITMLNGEK
TDMKLGGPVTRTDRYAHQAYCVQNYRIEMYCYCL*

FI08407.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23172-PA 651 GF23172-PA 17..649 7..634 1470 45.1 Plus
Dana\GF21500-PA 622 GF21500-PA 72..620 81..633 932 35.3 Plus
Dana\GF15639-PA 710 GF15639-PA 57..708 13..633 899 32.9 Plus
Dana\GF23862-PA 633 GF23862-PA 43..631 51..633 836 33.3 Plus
Dana\GF14010-PA 676 GF14010-PA 12..674 13..633 803 30.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24486-PA 633 GG24486-PA 1..633 1..634 3064 88.6 Plus
Dere\GG18499-PA 643 GG18499-PA 53..642 50..633 1387 45.3 Plus
Dere\GG23704-PA 705 GG23704-PA 57..703 13..633 1017 35.3 Plus
Dere\GG21349-PA 617 GG21349-PA 5..617 1..634 1003 36.4 Plus
Dere\GG21477-PA 631 GG21477-PA 44..630 52..633 828 32.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10451-PA 639 GH10451-PA 36..639 34..634 1338 42.1 Plus
Dgri\GH17533-PA 593 GH17533-PA 2..593 48..634 1325 42.5 Plus
Dgri\GH10450-PA 1018 GH10450-PA 428..1018 51..634 1297 43.8 Plus
Dgri\GH17532-PA 1146 GH17532-PA 556..1146 51..634 1273 43.4 Plus
Dgri\GH10304-PA 708 GH10304-PA 57..706 13..633 1010 34.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG3123-PA 634 CG3123-PA 1..634 1..634 3372 100 Plus
CG14731-PA 641 CG14731-PA 13..640 12..633 1397 43.7 Plus
CG1428-PA 617 CG1428-PA 42..617 47..634 998 38 Plus
CG16854-PC 677 CG16854-PC 29..675 13..633 986 34.2 Plus
CG16854-PB 705 CG16854-PB 57..703 13..633 986 34.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17703-PA 644 GI17703-PA 17..640 13..633 1138 38.9 Plus
Dmoj\GI16022-PA 716 GI16022-PA 57..714 13..633 989 33.7 Plus
Dmoj\GI10601-PA 589 GI10601-PA 4..584 50..633 575 25.4 Plus
Dmoj\GI12830-PA 656 GI12830-PA 27..651 8..633 567 27 Plus
Dmoj\GI12829-PA 691 GI12829-PA 236..686 189..633 553 28.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19066-PA 650 GL19066-PA 22..650 47..634 1459 45.8 Plus
Dper\GL25659-PA 619 GL25659-PA 5..617 9..633 1114 38.2 Plus
Dper\GL19540-PA 742 GL19540-PA 93..740 13..633 942 32.1 Plus
Dper\GL19661-PA 644 GL19661-PA 38..642 47..633 909 33.3 Plus
Dper\GL26124-PA 578 GL26124-PA 49..577 113..633 881 35.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25331-PA 614 GA25331-PA 2..614 63..634 1416 45.5 Plus
Dpse\GA12877-PA 619 GA12877-PA 5..617 9..633 1112 38.4 Plus
Dpse\GA14180-PA 750 GA14180-PA 101..748 13..633 943 32.1 Plus
Dpse\GA26048-PA 644 GA26048-PA 38..642 47..633 906 33 Plus
Dpse\GA11110-PA 573 GA11110-PA 49..572 113..633 890 36.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18193-PA 634 GM18193-PA 1..634 1..634 3342 96.8 Plus
Dsec\GM23986-PA 641 GM23986-PA 13..640 12..633 1411 43.7 Plus
Dsec\GM16148-PA 617 GM16148-PA 42..617 47..634 1021 38.4 Plus
Dsec\GM18862-PA 705 GM18862-PA 57..703 13..633 992 34.2 Plus
Dsec\GM16126-PA 631 GM16126-PA 44..630 52..633 826 32.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22799-PA 634 GD22799-PA 1..634 1..634 3357 97.3 Plus
Dsim\GD18788-PA 641 GD18788-PA 15..640 11..633 1388 43.3 Plus
Dsim\GD24337-PA 617 GD24337-PA 42..617 47..634 1006 38.1 Plus
Dsim\GD23760-PA 663 GD23760-PA 15..661 13..633 997 34.3 Plus
Dsim\GD21627-PA 631 GD21627-PA 44..630 52..633 828 32.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:21:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11419-PA 600 GJ11419-PA 7..600 45..634 1358 44.6 Plus
Dvir\GJ11409-PA 635 GJ11409-PA 50..635 51..634 1336 44.1 Plus
Dvir\GJ10531-PA 704 GJ10531-PA 57..702 13..633 1007 35.1 Plus
Dvir\GJ12972-PA 690 GJ12972-PA 160..685 113..633 566 28.2 Plus
Dvir\GJ22954-PA 582 GJ22954-PA 49..574 112..633 526 25.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18361-PA 711 GK18361-PA 57..709 13..633 989 34.9 Plus
Dwil\GK17756-PA 715 GK17756-PA 185..709 112..633 598 28.6 Plus
Dwil\GK22473-PA 560 GK22473-PA 52..559 115..634 539 26.2 Plus
Dwil\GK15328-PA 651 GK15328-PA 11..624 31..633 509 26.2 Plus
Dwil\GK15327-PA 713 GK15327-PA 223..670 193..634 491 27.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:21:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15011-PA 633 GE15011-PA 1..633 1..634 3014 87.4 Plus
Dyak\GE24210-PA 642 GE24210-PA 16..641 13..633 1437 43.6 Plus
Dyak\GE18511-PA 705 GE18511-PA 57..703 13..633 1005 34.5 Plus
Dyak\GE12978-PA 631 GE12978-PA 44..630 52..633 843 32.6 Plus
Dyak\GE15367-PA 673 GE15367-PA 39..671 48..633 770 29.4 Plus

FI08407.hyp Sequence

Translation from 2 to 1906

> FI08407.hyp
MKRKRVASRLFNIFLLAVLCYLILTSLSDRNKTISIREVPQIYINEEDEL
FVNTTGCRISATKPLSLYALSFMEPIEPVLCRMEQLMVAETIGDRNYLVR
NISRHGILSWRQVSCIYREFVRVDDAHNKYISLKFFKLTDRTRYLEVGTG
LQHIRTWCWVDFGRIIFHDVMYFLPPLPQATNRSTEHQKRKLSVMILGVD
SISHMHYMRYFHRVADFIEHLPHTEFWGYNRVALNTYPNLIPLVSGLSVS
EMEASCYHDELNFDKCNFLWNEFKRAGYSTIFAEDTDTAGLFIYRKRGFQ
KQPTDIYMRPLMTEIESHSLYRTTFDLKCTGHRLYGEFYYDFVSKLIPHM
ERQLFFSFLWNMHGIHDVFPYAKFVDKDYLSILTRLHEKGVMENTLILFM
GDHGLRFDKFARTAPGQHEMSQPLLIAIYPEWLKRRFPLAMSNFERNARS
LITTFDLHETLKDVIHLDRLTDANVRNRTLYLTNERGISLFLPIPQNRNC
KTAEIKQHYCLCNELKSVSTHESAIQEAASFAVDRINELIKPYPQCRVLS
LQSVRTAYRAKSSTYRGNYRVSQVMVRLKTTPGDGNFDATVLITMLNGEK
TDMKLGGPVTRTDRYAHQAYCVQNYRIEMYCYCL*

FI08407.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG3123-PA 634 CG3123-PA 1..634 1..634 3372 100 Plus
CG14731-PA 641 CG14731-PA 13..640 12..633 1397 43.7 Plus
CG1428-PA 617 CG1428-PA 42..617 47..634 998 38 Plus
CG16854-PC 677 CG16854-PC 29..675 13..633 986 34.2 Plus
CG16854-PB 705 CG16854-PB 57..703 13..633 986 34.2 Plus