Clone FI09229 Report

Search the DGRC for FI09229

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:92
Well:29
Vector:pFlc-1
Associated Gene/TranscriptEip71CD-RA
Protein status:FI09229.pep: gold
Sequenced Size:1012

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Eip71CD 2008-12-18 5.12 accounting

Clone Sequence Records

FI09229.complete Sequence

1012 bp assembled on 2008-09-24

GenBank Submission: BT044581.1

> FI09229.complete
GATCAGTTCAGCTTTAAATGTTAAAAGCGACACATTAAATAAATAACAAT
TTTAACTAGTGAAATCATGTCTCTGACTATTACTTCCAGTGTCACTCATC
CTGAGCTCAAGGATCTGAGCACCGTTCGCAATGAACAAAAGGAACTGAAC
ATTTCGCCGGTTCACGATGTGAATGTCACAAAAGCCACGGCCACTTTCGG
CATGGGTTGCTTTTGGGGCGCAGAATCCCTGTATGGAGCCACCCGTGGAG
TTTTGAGAACCACCGTGGGCTACGCCGGAGGCAGCTCGGATTTGCCAACG
TACCGTAAAATGGGCGATCATACGGAGGTGCTGGAAATCGACTATGATCC
CACGGTCATTAGCTTTAAGGAGCTGCTGGATCTGTTCTGGAACAACCATG
AGTATGGCCTGACCACGCCCATCAAGAGGCAGTACGCCTCCTTGATTCTG
TACCACGATGAGGAGCAGAAGCAGGTGGCACACGCCTCCAAATTGGAGGA
GCAAGAGCGCCGTGCACCGGAGATCATAACCACTGAGATTGCATCCAAGG
AGAACTTTTACCCAGCCGAGGCGTACCACCAGAAGTATAGGTTGCAGGGC
CACAAGGATCTCGCCTCATCGCTAAATCTCAGCCCCAAACTGCTGCAGAC
CAGCTATGTGGCCACCAAACTGAATGGCTACCTGGCCGGAGTCGGCGGCA
TCGAGCAGTTTAAGGCGGAGGCGGAGACCATGGGTCTGACGCCCACCCAG
CGGCAGTACTGCTACTACCACGTGGAGCAGAACGAGGGCCAGGGTCTCTA
CTGCTGACATGGCCGAATCTGCATAGACGTTAAGCGTAGATCGTACACCT
AGGGGGGTAATTTTATGGATAGTTTGCTTGTTCAAAAACAGATTGTGTAT
TACGTAGACTTAGAAACGTATGAAATATATATGAAACGCATATATTTTAT
TATTATAATAAAAAAAAATATCTCAAACTAAAAAAAAAAAAAAAAGAAAA
AAAAAAAAAAAA

FI09229.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
Eip71CD-RA 1102 Eip71CD-RA 119..1099 2..982 4890 99.8 Plus
Eip71CD.b 1116 Eip71CD.b 443..1113 312..982 3355 100 Plus
Eip71CD-RC 1110 Eip71CD-RC 443..1110 312..979 3340 100 Plus
Eip71CD.b 1116 Eip71CD.b 23..333 2..312 1540 99.6 Plus
Eip71CD-RC 1110 Eip71CD-RC 23..333 2..312 1540 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:54:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15502745..15503154 573..982 2005 99.3 Plus
chr3L 24539361 chr3L 15502425..15502688 312..575 1320 100 Plus
chr3L 24539361 chr3L 15502120..15502315 117..312 950 99 Plus
chr3L 24539361 chr3L 15501003..15501118 2..117 580 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
Eip71CD-RG 786 CG7266-PG 1..786 67..852 3915 99.9 Plus
Eip71CD-RA 741 CG7266-PA 1..741 67..807 3690 99.9 Plus
Eip71CD-RB 729 CG7266-PB 1..729 67..807 3475 98.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:21:42 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
Eip71CD-RG 980 CG7266-RG 3..980 2..979 4875 99.9 Plus
Eip71CD-RA 980 CG7266-RA 3..980 2..979 4875 99.9 Plus
Eip71CD-RB 968 CG7266-RB 3..968 2..979 4660 98.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
Eip71CD-PG 261 CG7266-PG 1..261 67..849 1365 99.6 Plus
Eip71CD-PA 246 CG7266-PA 1..246 67..804 1292 100 Plus
Eip71CD-PB 242 CG7266-PB 1..242 67..804 1255 98.4 Plus
Eip71CD-PF 245 CG7266-PF 16..245 115..804 1213 100 Plus
Eip71CD-PE 239 CG7266-PE 11..239 118..804 1209 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15512796..15513205 573..982 2050 100 Plus
3L 28110227 3L 15512476..15512739 312..575 1320 100 Plus
3L 28110227 3L 15512171..15512366 117..312 965 99.5 Plus
3L 28110227 3L 15511054..15511169 2..117 580 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15505896..15506305 573..982 2050 100 Plus
3L 28103327 3L 15505576..15505839 312..575 1320 100 Plus
3L 28103327 3L 15505271..15505466 117..312 965 99.4 Plus
3L 28103327 3L 15504154..15504269 2..117 580 100 Plus
Blast to na_te.dros performed 2014-11-27 02:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 101..177 919..995 151 66.2 Plus
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 1560..1636 995..919 151 66.2 Minus
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 1003..1062 988..926 118 69.8 Minus
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 9520..9579 988..926 118 69.8 Minus

FI09229.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:03:06 Download gff for FI09229.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15502745..15503111 573..939 99 == Plus
chr3L 15502425..15502685 312..572 100 -> Plus
chr3L 15502121..15502314 118..311 98 -> Plus
chr3L 15501001..15501118 1..117 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:59:50 Download gff for FI09229.complete
Subject Subject Range Query Range Percent Splice Strand
Eip71CD-RA 1..741 67..807 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:13:35 Download gff for FI09229.complete
Subject Subject Range Query Range Percent Splice Strand
Eip71CD-RA 1..741 67..807 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:18:15 Download gff for FI09229.complete
Subject Subject Range Query Range Percent Splice Strand
Eip71CD-RG 1..786 67..852 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:03:06 Download gff for FI09229.complete
Subject Subject Range Query Range Percent Splice Strand
Eip71CD-RG 1..786 67..852 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:51:38 Download gff for FI09229.complete
Subject Subject Range Query Range Percent Splice Strand
Eip71CD-RA 2..979 2..979 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:13:35 Download gff for FI09229.complete
Subject Subject Range Query Range Percent Splice Strand
Eip71CD-RA 2..979 2..979 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:18:15 Download gff for FI09229.complete
Subject Subject Range Query Range Percent Splice Strand
Eip71CD-RA 1..980 1..979 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-24 18:42:10 Download gff for FI09229.complete
Subject Subject Range Query Range Percent Splice Strand
Eip71CD-RA 2..979 2..979 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:03:06 Download gff for FI09229.complete
Subject Subject Range Query Range Percent Splice Strand
Eip71CD-RA 1..980 1..979 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:03:06 Download gff for FI09229.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15512796..15513202 573..979 100   Plus
3L 15512476..15512736 312..572 100 -> Plus
3L 15512172..15512365 118..311 99 -> Plus
3L 15511052..15511169 1..117 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:18:15 Download gff for FI09229.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15505896..15506302 573..979 100   Plus
arm_3L 15505576..15505836 312..572 100 -> Plus
arm_3L 15505272..15505465 118..311 99 -> Plus
arm_3L 15504152..15504269 1..117 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:44:11 Download gff for FI09229.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15505896..15506302 573..979 100   Plus
3L 15505576..15505836 312..572 100 -> Plus
3L 15505272..15505465 118..311 99 -> Plus
3L 15504152..15504269 1..117 99 -> Plus

FI09229.pep Sequence

Translation from 66 to 806

> FI09229.pep
MSLTITSSVTHPELKDLSTVRNEQKELNISPVHDVNVTKATATFGMGCFW
GAESLYGATRGVLRTTVGYAGGSSDLPTYRKMGDHTEVLEIDYDPTVISF
KELLDLFWNNHEYGLTTPIKRQYASLILYHDEEQKQVAHASKLEEQERRA
PEIITTEIASKENFYPAEAYHQKYRLQGHKDLASSLNLSPKLLQTSYVAT
KLNGYLAGVGGIEQFKAEAETMGLTPTQRQYCYYHVEQNEGQGLYC*

FI09229.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 19:42:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23704-PA 246 GF23704-PA 1..246 1..246 1229 91.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 19:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15904-PA 246 GG15904-PA 1..246 1..246 1311 98.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 19:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14544-PA 246 GH14544-PA 1..246 1..246 1140 84.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
Eip71CD-PA 246 CG7266-PA 1..246 1..246 1292 100 Plus
Eip71CD-PG 261 CG7266-PG 1..246 1..246 1292 100 Plus
Eip71CD-PB 242 CG7266-PB 1..242 1..246 1255 98.4 Plus
Eip71CD-PF 245 CG7266-PF 16..245 17..246 1213 100 Plus
Eip71CD-PE 239 CG7266-PE 11..239 18..246 1209 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 19:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13115-PA 246 GI13115-PA 1..246 1..246 1182 87.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 19:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24845-PA 246 GL24845-PA 1..246 1..246 1202 89 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 19:42:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20223-PA 246 GA20223-PA 1..246 1..246 1202 89 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 19:42:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25534-PA 246 GM25534-PA 1..246 1..246 1317 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 19:42:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14549-PA 246 GD14549-PA 1..246 1..246 1317 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 19:42:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13863-PA 246 GJ13863-PA 1..246 1..246 1170 87 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 19:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10595-PA 248 GK10595-PA 1..248 1..246 1172 87.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 19:42:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22245-PA 246 GE22245-PA 1..246 1..246 1307 98.4 Plus
Dyak\GE23149-PA 246 GE23149-PA 1..246 1..246 1307 98.4 Plus

FI09229.hyp Sequence

Translation from 66 to 806

> FI09229.hyp
MSLTITSSVTHPELKDLSTVRNEQKELNISPVHDVNVTKATATFGMGCFW
GAESLYGATRGVLRTTVGYAGGSSDLPTYRKMGDHTEVLEIDYDPTVISF
KELLDLFWNNHEYGLTTPIKRQYASLILYHDEEQKQVAHASKLEEQERRA
PEIITTEIASKENFYPAEAYHQKYRLQGHKDLASSLNLSPKLLQTSYVAT
KLNGYLAGVGGIEQFKAEAETMGLTPTQRQYCYYHVEQNEGQGLYC*

FI09229.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
Eip71CD-PA 246 CG7266-PA 1..246 1..246 1292 100 Plus
Eip71CD-PG 261 CG7266-PG 1..246 1..246 1292 100 Plus
Eip71CD-PB 242 CG7266-PB 1..242 1..246 1255 98.4 Plus
Eip71CD-PF 245 CG7266-PF 16..245 17..246 1213 100 Plus
Eip71CD-PE 239 CG7266-PE 11..239 18..246 1209 100 Plus