Clone FI09240 Report

Search the DGRC for FI09240

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:92
Well:40
Vector:pFlc-1
Associated Gene/TranscriptCG17109-RA
Protein status:FI09240.pep: gold
Sequenced Size:1330

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17109 2008-12-18 5.12 accounting

Clone Sequence Records

FI09240.complete Sequence

1330 bp assembled on 2008-12-09

GenBank Submission: BT053696.1

> FI09240.complete
CGGGTTCGAGTTTGGTGACTGGCAGCGAAAACATATCCACAAAATGAGTA
CCGAAAAGTGGGAGGACAACGAGGAAATCAAAATATTCCGCGAATATTTG
CGCATAGCTACGGTGCAGCCAAATGTGGATTACACCGAATGTGTGGAGTT
CCTGAAAAGGCAGGCTCACAGCCTGGATCTTCCCGTGGATGTTATATATC
CAGTGGAGAAGAAGCCTGTGGTGATCATCAAGTGGTTGGGCACCGAACCG
GAGCTGCCCTCCGTCATTCTCAACTCGCACATGGATGTGGTGCCGGTGTT
CCGTGACAAGTGGACCCACGATCCCTTCGCTGCCGATATCGATGAGGAGG
GCAGGATCTTTGCGCGCGGTACTCAGGACATGAAGTCGGTGGGCACAGGA
TATCTGGGTGCCATCCGCCTGCTTAAGGCAAGTGGTGTCCAGCCCAAGCG
CAATTTCTTCGTGACCTTTGTGCCCGATGAGGAGATCGGCGGCGAGCTGG
GCATGCAGGAGTTCGTCAAAACGGAATACTACAGCAACATGAATGTTGGT
TTCAGTCTGGACGAGGGCGGCACCAGTGAAATAGATCTGTTCTATGTCTT
TTATGCCGAACGTATGCGATGGGGTCTCAAGCTGAATTTCAGTGGAACCT
CTGGACACGGCTCCATGTTGCTGCCCAGCACTGCCGGCGTGAAACTGAAC
TATGTGCTCAACAAGCTGACGGAGTTCCGCGAATCGCAGGTTCAGAGGCT
GGCCAATGATCAGACAATCAACATCGGTGATGTGACAACTATCAATCTCA
CCCAGCTGAGCGGTGGAGTCCAGAGCAATGTGGTGCCTCCTCATTTCGAG
GCTGTCTTCGACATGCGTCTGTCCATCACCCTGGATGTGGTTGCCTTTGA
GAAACAGATCCACGATTGGTGCGAGGAGGCAGGTGGCGGCATCGAGATCT
CCTTCGACGAGAAGGAACCCTACGTGGCACCCACAAAGATCGACGACTCC
AATCCATTCTGGCTGGCTTTCAAGGCTGCCACCGATGAACTTGGCCTTAA
GATCTACCCCATTGTCTGCCCCGGTGCCACCGACAGCAGGAACATTCGAG
CTCAGGGCATTCCAGCCTTGGGATTCTCACCCATCAAAAATACCACCATG
CGCATCCATGATCACGATGAGTTCTTGGGCGCCGAAACTTATTTGAAGGG
CATTCAAATATACAAGAAAATTTTGGGCAACCTAGCGAATGTCTAAAAAC
TAAATCGAAATAATACATGAAAACCTTATCAAAATAAAGATTGATGATTT
TGTTATAAGTTAGCAAAAAAAAAAAAAAAA

FI09240.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:14:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG17109-RA 1464 CG17109-RA 94..1409 5..1320 6535 99.7 Plus
CG6726-RB 1456 CG6726-RB 74..445 40..408 605 77.9 Plus
CG6733-RA 1639 CG6733-RA 425..739 267..581 600 79.3 Plus
CG6733-RA 1639 CG6733-RA 937..1244 779..1086 520 77.9 Plus
CG6733-RA 1639 CG6733-RA 763..888 605..730 300 82.5 Plus
CG6733-RA 1639 CG6733-RA 197..321 42..166 265 80.8 Plus
CG6733-RA 1639 CG6733-RA 1270..1331 1112..1173 190 87 Plus
CG6726-RB 1456 CG6726-RB 813..871 776..834 190 88.1 Plus
CG6726-RB 1456 CG6726-RB 913..979 876..942 170 83.5 Plus
CG6726-RB 1456 CG6726-RB 676..775 639..738 170 78 Plus
CG6726-RB 1456 CG6726-RB 1143..1255 1106..1218 145 75.2 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18919310..18919800 135..625 2455 100 Plus
chr3R 27901430 chr3R 18919858..18920276 623..1041 2095 100 Plus
chr3R 27901430 chr3R 18920336..18920607 1042..1313 1360 100 Plus
chr3R 27901430 chr3R 18921339..18921827 140..625 655 76.1 Plus
chr3R 27901430 chr3R 18919121..18919250 5..134 635 99.2 Plus
chr3R 27901430 chr3R 18921887..18922299 626..1038 610 76.5 Plus
chr3R 27901430 chr3R 18923706..18924012 643..949 455 76.5 Plus
chr3R 27901430 chr3R 18923225..18923588 215..578 425 74.5 Plus
chr3R 27901430 chr3R 18915493..18915918 145..567 385 73.2 Plus
chr3R 27901430 chr3R 18916043..18916346 639..942 365 74.7 Plus
chr3R 27901430 chr3R 18915294..18915388 40..134 250 84.2 Plus
chr3R 27901430 chr3R 18917336..18917518 211..393 240 75.4 Plus
chr3R 27901430 chr3R 18921184..18921268 42..126 185 81.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG17109-RB 1203 CG17109-PB 1..1203 44..1246 6000 99.9 Plus
CG17109-RA 1203 CG17109-PA 1..1203 44..1246 6000 99.9 Plus
CG6733-RA 1206 CG6733-PA 10..1133 53..1173 1565 76.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:21:47 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG17109-RB 1373 CG17109-RB 5..1313 5..1313 6530 99.9 Plus
CG17109-RA 1313 CG17109-RA 5..1313 5..1313 6530 99.9 Plus
CG6733-RA 1291 CG6733-RA 30..1164 42..1173 1575 76.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG17109-PB 400 CG17109-PB 1..400 44..1243 2097 100 Plus
CG17109-PA 400 CG17109-PA 1..400 44..1243 2097 100 Plus
CG6733-PA 401 CG6733-PA 1..401 44..1243 1663 77.1 Plus
CG6738-PA 401 CG6738-PA 1..401 44..1243 1565 72.8 Plus
CG6726-PC 401 CG6726-PC 1..400 44..1240 1481 68.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23095883..23096373 135..625 2455 100 Plus
3R 32079331 3R 23096431..23096849 623..1041 2095 100 Plus
3R 32079331 3R 23096909..23097187 1042..1320 1365 99.3 Plus
3R 32079331 3R 23097912..23098400 140..625 640 75.9 Plus
3R 32079331 3R 23095694..23095823 5..134 635 99.2 Plus
3R 32079331 3R 23098460..23098872 626..1038 625 76.8 Plus
3R 32079331 3R 23100283..23100589 643..949 455 76.5 Plus
3R 32079331 3R 23099802..23100165 215..578 425 74.5 Plus
3R 32079331 3R 23092066..23092491 145..567 385 73.2 Plus
3R 32079331 3R 23092616..23092919 639..942 365 74.7 Plus
3R 32079331 3R 23091867..23091961 40..134 265 85.3 Plus
3R 32079331 3R 23093909..23094091 211..393 240 75.4 Plus
3R 32079331 3R 23099003..23099064 1112..1173 190 87.1 Plus
3R 32079331 3R 23097757..23097841 42..126 185 81.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22836714..22837204 135..625 2455 100 Plus
3R 31820162 3R 22837262..22837680 623..1041 2095 100 Plus
3R 31820162 3R 22837740..22838018 1042..1320 1365 99.2 Plus
3R 31820162 3R 22836525..22836654 5..134 635 99.2 Plus
3R 31820162 3R 22838873..22839187 267..581 600 79.3 Plus
3R 31820162 3R 22839444..22839703 779..1038 490 79.2 Plus
3R 31820162 3R 22832897..22833163 145..408 365 76.4 Plus
3R 31820162 3R 22840673..22840841 255..423 365 81 Plus
3R 31820162 3R 22841243..22841372 772..901 305 82.3 Plus
3R 31820162 3R 22832698..22832792 40..134 265 85.2 Plus
3R 31820162 3R 22834740..22834922 211..393 240 75.4 Plus
3R 31820162 3R 22839291..22839395 626..730 225 80.9 Plus
3R 31820162 3R 22839834..22839895 1112..1173 190 87 Plus
3R 31820162 3R 22833584..22833642 776..834 190 88.1 Plus
3R 31820162 3R 22838588..22838672 42..126 185 81.1 Plus
3R 31820162 3R 22841114..22841209 643..738 180 79.1 Plus
3R 31820162 3R 22833684..22833750 876..942 170 83.5 Plus
3R 31820162 3R 22833447..22833546 639..738 170 78 Plus
3R 31820162 3R 22840402..22840463 41..102 160 83.8 Plus
3R 31820162 3R 22835362..22835421 775..834 150 83.3 Plus
3R 31820162 3R 22833977..22834089 1106..1218 145 75.2 Plus
Blast to na_te.dros performed on 2014-11-26 19:02:37 has no hits.

FI09240.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:23:54 Download gff for FI09240.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18920336..18920607 1042..1314 99   Plus
chr3R 18919859..18920276 624..1041 100 -> Plus
chr3R 18919310..18919798 135..623 100 -> Plus
chr3R 18919117..18919250 1..134 97 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:03:56 Download gff for FI09240.complete
Subject Subject Range Query Range Percent Splice Strand
CG17109-RA 1..1203 44..1246 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:21:53 Download gff for FI09240.complete
Subject Subject Range Query Range Percent Splice Strand
CG17109-RA 1..1203 44..1246 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:25:59 Download gff for FI09240.complete
Subject Subject Range Query Range Percent Splice Strand
CG17109-RA 1..1203 44..1246 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:23:54 Download gff for FI09240.complete
Subject Subject Range Query Range Percent Splice Strand
CG17109-RA 1..1203 44..1246 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-09 17:59:04 Download gff for FI09240.complete
Subject Subject Range Query Range Percent Splice Strand
CG17109-RA 2..1310 5..1313 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:21:53 Download gff for FI09240.complete
Subject Subject Range Query Range Percent Splice Strand
CG17109-RA 4..1312 5..1313 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:25:59 Download gff for FI09240.complete
Subject Subject Range Query Range Percent Splice Strand
CG17109-RA 1..1313 1..1313 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:23:54 Download gff for FI09240.complete
Subject Subject Range Query Range Percent Splice Strand
CG17109-RA 1..1313 1..1313 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:23:54 Download gff for FI09240.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23096909..23097180 1042..1314 99   Plus
3R 23096432..23096849 624..1041 100 -> Plus
3R 23095883..23096371 135..623 100 -> Plus
3R 23095690..23095823 1..134 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:25:59 Download gff for FI09240.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18922631..18922902 1042..1314 99   Plus
arm_3R 18922154..18922571 624..1041 100 -> Plus
arm_3R 18921605..18922093 135..623 100 -> Plus
arm_3R 18921412..18921545 1..134 97 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:33 Download gff for FI09240.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22837740..22838011 1042..1314 99   Plus
3R 22837263..22837680 624..1041 100 -> Plus
3R 22836714..22837202 135..623 100 -> Plus
3R 22836521..22836654 1..134 97 -> Plus

FI09240.pep Sequence

Translation from 1 to 1245

> FI09240.pep
GFEFGDWQRKHIHKMSTEKWEDNEEIKIFREYLRIATVQPNVDYTECVEF
LKRQAHSLDLPVDVIYPVEKKPVVIIKWLGTEPELPSVILNSHMDVVPVF
RDKWTHDPFAADIDEEGRIFARGTQDMKSVGTGYLGAIRLLKASGVQPKR
NFFVTFVPDEEIGGELGMQEFVKTEYYSNMNVGFSLDEGGTSEIDLFYVF
YAERMRWGLKLNFSGTSGHGSMLLPSTAGVKLNYVLNKLTEFRESQVQRL
ANDQTINIGDVTTINLTQLSGGVQSNVVPPHFEAVFDMRLSITLDVVAFE
KQIHDWCEEAGGGIEISFDEKEPYVAPTKIDDSNPFWLAFKAATDELGLK
IYPIVCPGATDSRNIRAQGIPALGFSPIKNTTMRIHDHDEFLGAETYLKG
IQIYKKILGNLANV*

FI09240.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 17:52:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16977-PA 400 GF16977-PA 1..400 15..414 1997 92 Plus
Dana\GF16978-PA 397 GF16978-PA 3..397 20..414 1633 73.7 Plus
Dana\GF16979-PA 398 GF16979-PA 2..398 18..414 1554 71.8 Plus
Dana\GF16975-PA 401 GF16975-PA 1..400 15..413 1483 66.8 Plus
Dana\GF16976-PA 401 GF16976-PA 1..400 15..413 1423 63.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 17:52:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11186-PA 400 GG11186-PA 1..400 15..414 2118 99 Plus
Dere\GG11187-PA 398 GG11187-PA 1..398 15..414 1637 76.1 Plus
Dere\GG11184-PA 401 GG11184-PA 1..401 15..414 1528 69.1 Plus
Dere\GG11185-PA 402 GG11185-PA 6..401 18..413 1333 62 Plus
Dere\GG17281-PA 401 GG17281-PA 1..399 15..412 1306 59.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 17:52:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23739-PA 401 GH23739-PA 1..401 15..414 1504 68.1 Plus
Dgri\GH23814-PA 400 GH23814-PA 1..400 15..414 1464 67.3 Plus
Dgri\GH23872-PA 401 GH23872-PA 1..401 15..414 1450 64.3 Plus
Dgri\GH11206-PA 402 GH11206-PA 1..401 15..414 1320 60.6 Plus
Dgri\GH11748-PA 402 GH11748-PA 1..401 15..414 1306 60.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 17:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG17109-PB 400 CG17109-PB 1..400 15..414 2097 100 Plus
CG17109-PA 400 CG17109-PA 1..400 15..414 2097 100 Plus
CG6733-PA 401 CG6733-PA 1..401 15..414 1663 77.1 Plus
CG6738-PA 401 CG6738-PA 1..401 15..414 1565 72.8 Plus
CG6726-PC 401 CG6726-PC 1..400 15..413 1481 68.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 17:52:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23017-PA 401 GI23017-PA 1..401 15..414 1497 68.6 Plus
Dmoj\GI23020-PA 401 GI23020-PA 1..401 15..414 1441 64.1 Plus
Dmoj\GI23018-PA 399 GI23018-PA 1..398 15..413 1389 64.2 Plus
Dmoj\GI23019-PA 401 GI23019-PA 1..401 15..414 1367 61.8 Plus
Dmoj\GI18128-PA 402 GI18128-PA 1..401 15..414 1312 61 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 17:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13664-PA 401 GL13664-PA 1..400 15..413 1674 75.5 Plus
Dper\GL13662-PA 401 GL13662-PA 1..400 15..413 1515 68.5 Plus
Dper\GL13663-PA 401 GL13663-PA 1..401 15..414 1472 67.1 Plus
Dper\GL23825-PA 406 GL23825-PA 1..401 15..414 1295 59.9 Plus
Dper\GL23826-PA 401 GL23826-PA 1..401 15..414 1242 56.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 17:52:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19818-PA 401 GA19818-PA 1..400 15..413 1677 75.8 Plus
Dpse\GA19815-PA 401 GA19815-PA 1..400 15..413 1515 68.8 Plus
Dpse\GA26984-PA 401 GA26984-PA 1..401 15..414 1474 67.1 Plus
Dpse\GA29129-PA 406 GA29129-PA 1..401 15..414 1290 59.6 Plus
Dpse\GA27068-PA 406 GA27068-PA 1..401 15..414 1290 59.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 17:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26486-PA 400 GM26486-PA 1..400 15..414 2123 99.2 Plus
Dsec\GM26487-PA 401 GM26487-PA 1..401 15..414 1698 77.3 Plus
Dsec\GM26483-PA 401 GM26483-PA 1..401 15..414 1504 67.6 Plus
Dsec\GM26165-PA 401 GM26165-PA 1..401 15..414 1325 60.1 Plus
Dsec\GM26485-PA 402 GM26485-PA 6..401 18..413 1309 63 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 17:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20999-PA 400 GD20999-PA 1..400 15..414 2129 99.8 Plus
Dsim\GD21000-PA 401 GD21000-PA 1..401 15..414 1712 77.8 Plus
Dsim\GD21001-PA 401 GD21001-PA 1..401 15..414 1613 73.6 Plus
Dsim\GD20996-PA 401 GD20996-PA 1..401 15..414 1509 67.8 Plus
Dsim\GD20998-PA 402 GD20998-PA 6..401 18..413 1308 62.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 17:52:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24611-PA 401 GJ24611-PA 1..401 15..414 1511 68.8 Plus
Dvir\GJ24612-PA 399 GJ24612-PA 1..399 15..414 1437 67 Plus
Dvir\GJ24614-PA 401 GJ24614-PA 1..401 15..414 1432 64.1 Plus
Dvir\GJ17753-PA 402 GJ17753-PA 1..401 15..414 1257 60.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 17:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14410-PA 401 GK14410-PA 1..400 15..413 1541 70 Plus
Dwil\GK14413-PA 401 GK14413-PA 1..401 15..414 1510 68.6 Plus
Dwil\GK14412-PA 400 GK14412-PA 1..399 15..413 1426 67 Plus
Dwil\GK22579-PA 401 GK22579-PA 1..401 15..414 1288 59.4 Plus
Dwil\GK22580-PA 403 GK22580-PA 1..403 15..414 1192 55.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 17:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10353-PA 400 GE10353-PA 1..400 15..414 2124 99.5 Plus
Dyak\GE10354-PA 401 GE10354-PA 1..401 15..414 1728 79.1 Plus
Dyak\GE10355-PA 401 GE10355-PA 1..401 15..414 1627 74.6 Plus
Dyak\GE10351-PA 401 GE10351-PA 1..401 15..414 1516 68.3 Plus
Dyak\GE24682-PA 401 GE24682-PA 1..401 15..414 1331 59.9 Plus

FI09240.hyp Sequence

Translation from 1 to 1245

> FI09240.hyp
TFEFGDWQRKHIHKMSTEKWEDNEEIKIFREYLRIATVQPNVDYTECVEF
LKRQAHSLDLPVDVIYPVEKKPVVIIKWLGTEPELPSVILNSHMDVVPVF
RDKWTHDPFAADIDEEGRIFARGTQDMKSVGTGYLGAIRLLKASGVQPKR
NFFVTFVPDEEIGGELGMQEFVKTEYYSNMNVGFSLDEGGTSEIDLFYVF
YAERMRWGLKLNFSGTSGHGSMLLPSTAGVKLNYVLNKLTEFRESQVQRL
ANDQTINIGDVTTINLTQLSGGVQSNVVPPHFEAVFDMRLSITLDVVAFE
KQIHDWCEEAGGGIEISFDEKEPYVAPTKIDDSNPFWLAFKAATDELGLK
IYPIVCPGATDSRNIRAQGIPALGFSPIKNTTMRIHDHDEFLGAETYLKG
IQIYKKILGNLANV*

FI09240.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG17109-PB 400 CG17109-PB 1..400 15..414 2097 100 Plus
CG17109-PA 400 CG17109-PA 1..400 15..414 2097 100 Plus
CG6733-PA 401 CG6733-PA 1..401 15..414 1663 77.1 Plus
CG6738-PA 401 CG6738-PA 1..401 15..414 1565 72.8 Plus
CG6726-PC 401 CG6726-PC 1..400 15..413 1481 68.2 Plus