Clone FI09322 Report

Search the DGRC for FI09322

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:93
Well:22
Vector:pFlc-1
Associated Gene/TranscriptDp-RB
Protein status:FI09322.pep: gold
Sequenced Size:2461

Clone Sequence Records

FI09322.complete Sequence

2461 bp assembled on 2008-12-22

GenBank Submission: BT056266.1

> FI09322.complete
AGTTACTCGCTAACACTCTGACACCCATGTGTGTGTCTGTGGAGTACATG
CAGTTTTGTTATCAACGACGGCATTTCAGTCGCGTGTTATGTGTATATCG
GAAACTAAGGAACCTCCGCATCTTCCAATTTCCAATTCTGCAGGACAAAT
ATCCAAAATGCTGAAGCCGGCCCAGAACAAGTCCGAAATGGAGGGAGGTA
AGCCCGTGGCGGTGGTCTACGCCACCGGCTCATCCGCGCGCAACAGCGGA
AGTGCTAGCGGCATCGGCAACGTGGGACGCATGGGCGCCTTTAGTCAGAT
GGGCAGTCAAGGGCAGTTTATACGACTGCAGGACAACGGACTGTCCATTC
CAAAAACAGAAGCAGGTACCACCTACACCACCGTTTCGGCGCAAAAGACT
TCGGGTGCTGGCAGTGGTCATTACGACTTGCCCTTGAAGGGAGATCGCTA
TGTGAAGTTTACACCAAATCCCATAAAAATGAAATCAAAACTCCATGCCA
TTCAGAGCAACTCGTTGCACTCCATGTCGGCCTCCTCATCGTCCGTTCAA
AGGAAACGCAAGCCGGACAAGGCAGGCAAAGGTTTGCGCCATTTCTCGAT
GAAGGTATGCGAAAAGGTGGAGGAGAAGGGCAAGACCACCTACAATGAGG
TGGCCGACGACCTGGTCAGCGAGGAGATGAAGAACAATGCGTACGACAAC
AACTGTGATCAAAAGAATATCCGACGTCGTGTCTACGATGCGCTCAACGT
ACTGATGGCAATCAATGTTATTTCCAAGGACAAGAAGGAGATTCGCTGGA
TAGGACTGCCCGCAAATTCGACAGAGACATTTCTGGCCCTGGAAGAGGAA
AACTGTCAGCGCCGCGAGCGAATAAAACAGAAAAACGAAATGTTGCGCGA
AATGATCATGCAGCATGTGGCGTTCAAGGGATTGGTCGAGCGGAACAAGC
GAAACGAGAGCCAAGGCGTGGTGCCTTCCCCGAATGCCTCGATCCAGCTA
CCGTTCATCATCGTGAACACGCACAAGTCCACGAAAATCAACTGCAGTGT
GACCAACGACAAGTCCGAATACATATTCAAGTTCGACAAAACCTTCGAAA
TGCACGATGACATTGAGGTGCTCAAGCGTATGGGATTCCTATTGGGACTG
GATAAGGGCGAATGCACGCCGGAGAACATTGAACGAGTCAAGTCGTGGGT
GCCTCCAAACCTTGCCAAATACGTAGAAGCCTACGGCACCGGCAAGACTG
GCGAAAATATGTACGAATCGGATGACGAGGACAATGAGTTCAACGGGTAC
CTGGAGTCGGCCAATGAGTCCCAGGGCTTTGCACAACACTCGGCACAACA
CACCACCGATGGCGAGTTCAAGCTGGAGATGGATGATGACGAGCTGGACG
ACGACATTGATTGAGCTGATGGTGCCGCCGTCATTGTGCCAGCCATGGCC
GATGCGGACACGGATGCGGATGGAGGAGCAGATGCTGATGCGGAGGACAC
GTTTAGTTTTACGTTTATCAACGCTTTGTTAGGTTTGCCACGGCCCCCTG
GTTAGTCAGGAGCCGCACTCCACTCCAATCCACTCCACACCCAATCCGAC
CCACCCACACAATTGGTTTTGTTTACTTCTCAATGAGACTCTTAAATTAT
ATATATACAATCTCGCAGCGACGAGAAAGATTCGGTAGTTCATGTATGTA
AGTGTAGTTTGCATACACAGTTTGTAATTGTATCATTGAAGATTTATGTT
TAAGCTGAAACGTTTTTAAAATAATTTGTCTAGTTAAGGAGAACGCGTTT
TTAGTTCAAACCACAATTCACATAAGGCAATACCGCGAAACCACATGCCC
AGACTAATGTTCACTCTCTAATTAGTTGTTATCAGTCTCCCTTTTCCCCC
CAATGGCCTTTTCATGTTTGGGTAGGCTTAAGCAAAAGCGATAATGTTAT
GGGTAATTGTCTCTTAATAATATAATATACCAAAACTGTACACAACCGCA
GTGAAATGCAATTATTTTTAGAATGCCACGAGCAGTTTGAACTGCAGACA
AGAGCGAACATATGAAATATGTTTAATTTGCTAACACCCTTTGACAAAGC
GATTCTTTTAGATTCTCAAAACCCAAATTTTAAGTTGACAAGGGAGTGCA
GATAGTTGCGAAATAATCAACCTACCTAATTAGTAATAACAATTAAAACA
CGATATACATTTTCAGAATTTGTATTTATATTATTGAACCCTCTTCAAGT
GAATACAACAGCATGCAAATACAAATTAGTAGTCAAGTATAAGGCGTTAA
CAATTAAGTGTCGAGCATGTAGTTGTGTAATGAAACGAAATAATTGCATG
GATGGAAAGGAAATTGCAAACAAGTGAGACGAAATCGAACCGAGTGACAA
GTTAATAAAGAAGTAATTTGCATATTGTAAAATATGATAAACAGAGAAAA
AAAAAAAAAAA

FI09322.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dp-RB 2507 Dp-RB 24..2471 1..2448 12240 100 Plus
Dp.d 2379 Dp.d 69..2374 143..2448 11530 100 Plus
Dp.e 3066 Dp.e 1810..3030 1228..2448 6105 100 Plus
Dp.e 3066 Dp.e 669..1755 143..1229 5435 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9114340..9115558 1228..2446 6080 99.9 Plus
chr2R 21145070 chr2R 9113358..9113691 493..826 1670 100 Plus
chr2R 21145070 chr2R 9112680..9112981 1..302 1510 100 Plus
chr2R 21145070 chr2R 9113758..9113997 825..1064 1200 100 Plus
chr2R 21145070 chr2R 9113163..9113294 361..492 660 100 Plus
chr2R 21145070 chr2R 9114201..9114285 1145..1229 425 100 Plus
chr2R 21145070 chr2R 9114056..9114139 1063..1146 420 100 Plus
chr2R 21145070 chr2R 9113046..9113107 301..362 310 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dp-RB 1326 CG4654-PB 1..1326 89..1414 6630 100 Plus
Dp-RA 1338 CG4654-PA 67..1338 143..1414 6360 100 Plus
Dp-RC 1254 CG4654-PC 1..1254 158..1414 6205 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:21:54 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dp-RB 2448 CG4654-RB 3..2448 1..2446 12230 100 Plus
Dp-RA 2526 CG4654-RA 680..2526 143..1989 9235 100 Plus
Dp-RC 1913 CG4654-RC 69..1913 142..1989 9160 99.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dp-PB 441 CG4654-PB 1..431 89..1381 2077 100 Plus
Dp-PA 445 CG4654-PA 20..435 134..1381 1984 99.5 Plus
Dp-PC 417 CG4654-PC 1..407 158..1381 1940 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13226984..13228204 1228..2448 6105 100 Plus
2R 25286936 2R 13226002..13226335 493..826 1670 100 Plus
2R 25286936 2R 13225324..13225625 1..302 1510 100 Plus
2R 25286936 2R 13226402..13226641 825..1064 1200 100 Plus
2R 25286936 2R 13225807..13225938 361..492 660 100 Plus
2R 25286936 2R 13226845..13226929 1145..1229 425 100 Plus
2R 25286936 2R 13226700..13226783 1063..1146 420 100 Plus
2R 25286936 2R 13225690..13225751 301..362 310 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:35:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13228183..13229403 1228..2448 6105 100 Plus
2R 25260384 2R 13227201..13227534 493..826 1670 100 Plus
2R 25260384 2R 13226523..13226824 1..302 1510 100 Plus
2R 25260384 2R 13227601..13227840 825..1064 1200 100 Plus
2R 25260384 2R 13227006..13227137 361..492 660 100 Plus
2R 25260384 2R 13228044..13228128 1145..1229 425 100 Plus
2R 25260384 2R 13227899..13227982 1063..1146 420 100 Plus
2R 25260384 2R 13226889..13226950 301..362 310 100 Plus
Blast to na_te.dros performed on 2014-11-26 20:15:52 has no hits.

FI09322.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:25:05 Download gff for FI09322.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9114342..9115558 1230..2446 99   Plus
chr2R 9114202..9114285 1146..1229 100 -> Plus
chr2R 9114056..9114138 1063..1145 100 -> Plus
chr2R 9113760..9113995 827..1062 100 -> Plus
chr2R 9113358..9113691 493..826 100 -> Plus
chr2R 9113165..9113294 363..492 100 -> Plus
chr2R 9113047..9113107 302..362 100 -> Plus
chr2R 9112680..9112980 1..301 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:20 Download gff for FI09322.complete
Subject Subject Range Query Range Percent Splice Strand
Dp-RB 1..1326 89..1414 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:26:45 Download gff for FI09322.complete
Subject Subject Range Query Range Percent Splice Strand
Dp-RB 1..1326 89..1414 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:00:42 Download gff for FI09322.complete
Subject Subject Range Query Range Percent Splice Strand
Dp-RB 1..1326 89..1414 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:25:05 Download gff for FI09322.complete
Subject Subject Range Query Range Percent Splice Strand
Dp-RB 1..1326 89..1414 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-22 12:02:21 Download gff for FI09322.complete
Subject Subject Range Query Range Percent Splice Strand
Dp-RB 1..2446 1..2446 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:26:45 Download gff for FI09322.complete
Subject Subject Range Query Range Percent Splice Strand
Dp-RB 1..2446 1..2446 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:00:42 Download gff for FI09322.complete
Subject Subject Range Query Range Percent Splice Strand
Dp-RB 3..2448 1..2446 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:25:05 Download gff for FI09322.complete
Subject Subject Range Query Range Percent Splice Strand
Dp-RB 3..2448 1..2446 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:25:05 Download gff for FI09322.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13226986..13228202 1230..2446 100   Plus
2R 13226846..13226929 1146..1229 100 -> Plus
2R 13226700..13226782 1063..1145 100 -> Plus
2R 13226404..13226639 827..1062 100 -> Plus
2R 13226002..13226335 493..826 100 -> Plus
2R 13225809..13225938 363..492 100 -> Plus
2R 13225691..13225751 302..362 100 -> Plus
2R 13225324..13225624 1..301 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:00:42 Download gff for FI09322.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9114491..9115707 1230..2446 100   Plus
arm_2R 9114351..9114434 1146..1229 100 -> Plus
arm_2R 9114205..9114287 1063..1145 100 -> Plus
arm_2R 9113909..9114144 827..1062 100 -> Plus
arm_2R 9113507..9113840 493..826 100 -> Plus
arm_2R 9113314..9113443 363..492 100 -> Plus
arm_2R 9113196..9113256 302..362 100 -> Plus
arm_2R 9112829..9113129 1..301 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:59:15 Download gff for FI09322.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13228185..13229401 1230..2446 100   Plus
2R 13228045..13228128 1146..1229 100 -> Plus
2R 13227899..13227981 1063..1145 100 -> Plus
2R 13227603..13227838 827..1062 100 -> Plus
2R 13227201..13227534 493..826 100 -> Plus
2R 13227008..13227137 363..492 100 -> Plus
2R 13226890..13226950 302..362 100 -> Plus
2R 13226523..13226823 1..301 100 -> Plus

FI09322.pep Sequence

Translation from 88 to 1413

> FI09322.pep
MCISETKEPPHLPISNSAGQISKMLKPAQNKSEMEGGKPVAVVYATGSSA
RNSGSASGIGNVGRMGAFSQMGSQGQFIRLQDNGLSIPKTEAGTTYTTVS
AQKTSGAGSGHYDLPLKGDRYVKFTPNPIKMKSKLHAIQSNSLHSMSASS
SSVQRKRKPDKAGKGLRHFSMKVCEKVEEKGKTTYNEVADDLVSEEMKNN
AYDNNCDQKNIRRRVYDALNVLMAINVISKDKKEIRWIGLPANSTETFLA
LEEENCQRRERIKQKNEMLREMIMQHVAFKGLVERNKRNESQGVVPSPNA
SIQLPFIIVNTHKSTKINCSVTNDKSEYIFKFDKTFEMHDDIEVLKRMGF
LLGLDKGECTPENIERVKSWVPPNLAKYVEAYGTGKTGENMYESDDEDNE
FNGYLESANESQGFAQHSAQHTTDGEFKLEMDDDELDDDID*

FI09322.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11948-PA 444 GF11948-PA 26..431 19..428 1761 84.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20367-PA 446 GG20367-PA 20..436 16..431 2070 95.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20730-PA 450 GH20730-PA 29..437 19..428 1625 76 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dp-PB 441 CG4654-PB 1..441 1..441 2292 100 Plus
Dp-PA 445 CG4654-PA 20..445 16..441 2199 99.5 Plus
Dp-PC 417 CG4654-PC 1..417 24..441 2155 99.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20813-PA 447 GI20813-PA 28..434 19..428 1530 75.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11558-PA 181 GL11558-PA 29..152 19..139 385 67.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18332-PA 446 GA18332-PA 29..427 19..422 1674 82.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21454-PA 447 GM21454-PA 20..437 16..431 2121 97.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10952-PA 383 GD10952-PA 20..378 16..373 1777 96.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20546-PA 447 GJ20546-PA 28..434 19..428 1531 76.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22007-PA 456 GK22007-PA 24..442 19..428 1620 76.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12526-PA 446 GE12526-PA 20..436 16..431 2088 95 Plus

FI09322.hyp Sequence

Translation from 88 to 1413

> FI09322.hyp
MCISETKEPPHLPISNSAGQISKMLKPAQNKSEMEGGKPVAVVYATGSSA
RNSGSASGIGNVGRMGAFSQMGSQGQFIRLQDNGLSIPKTEAGTTYTTVS
AQKTSGAGSGHYDLPLKGDRYVKFTPNPIKMKSKLHAIQSNSLHSMSASS
SSVQRKRKPDKAGKGLRHFSMKVCEKVEEKGKTTYNEVADDLVSEEMKNN
AYDNNCDQKNIRRRVYDALNVLMAINVISKDKKEIRWIGLPANSTETFLA
LEEENCQRRERIKQKNEMLREMIMQHVAFKGLVERNKRNESQGVVPSPNA
SIQLPFIIVNTHKSTKINCSVTNDKSEYIFKFDKTFEMHDDIEVLKRMGF
LLGLDKGECTPENIERVKSWVPPNLAKYVEAYGTGKTGENMYESDDEDNE
FNGYLESANESQGFAQHSAQHTTDGEFKLEMDDDELDDDID*

FI09322.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dp-PB 441 CG4654-PB 1..441 1..441 2292 100 Plus
Dp-PA 445 CG4654-PA 20..445 16..441 2199 99.5 Plus
Dp-PC 417 CG4654-PC 1..417 24..441 2155 99.8 Plus