Clone FI09323 Report

Search the DGRC for FI09323

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:93
Well:23
Vector:pFlc-1
Associated Gene/TranscriptCG9422-RA
Protein status:FI09323.pep: gold
Sequenced Size:799

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9422 2008-12-18 5.12 accounting

Clone Sequence Records

FI09323.complete Sequence

799 bp assembled on 2008-09-12

GenBank Submission: BT044425.1

> FI09323.complete
GCTGGTTTATATTTTGCTGTGCACATATTGGTGAAACTATTTAATAATAT
TTATTAAGATTTTACGGAAGGCCTCAAAATGATGCACTACCGCAAGGCCG
AGAATGTGGAGAAGGAGCTGAGCAAGAGCGATCTGCCATTCGAGGACTGC
ATGCCAAAGTCCCAAAAGGATTTTTTGTGGATGCATGTAAAAGGCGGTAC
CAAAGTGAGCAATGTGATTGAGTTTGCTCAGGAGGCGCTGAACAAGGGCG
AGCACAGATGCGTGGTGTGGAGCGGATCCGGCGGAGGAGTGGTGAAGACC
ATATCCTGTGCCGAGGTCCTCAAGCGGAGCCACCCCCTCTACCAGGTGAC
GCGCATGGCCTACACCAGTGTGGAGGAGCACTGGAAGCCGCAAATGGAAG
GCCTGGAGGAGATTATAGTCACACGCCAAATACCCACCCTGCACATCCTC
ATGAGTCTGGACGAGCTGCCGGATACTATAGATGGCTTACAAAAGCCAAA
TACGTCCACTGATTTTTGGGATGGCGGAGGAGCACAGCAACAGCCACATC
CACGTTCCCAGCCCCGCCATCAGCAGCAGCCACATAAACCAGGGGCTGGG
CGTGGGGGTCGGCCGAACAAACGGACCAGACCCGGACGCAATAAACCAGG
CCAACAACCCGAAAAACCTGCCGCTGAAGAGAATTTACCCGCCAGTTAGA
GTCAAGGTTGAGATAAGCGGACCATGCGAAGATTTTCTTATTTGCCCTTT
GTAAGGATGTACAAATAAAGCCCAATTTATCACAAAAAAAAAAAAAAAA

FI09323.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:00:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG9422-RC 1003 CG9422-RC 1..787 1..787 3920 99.8 Plus
CG9422.a 1383 CG9422.a 29..815 1..787 3920 99.8 Plus
CG9422.b 1355 CG9422.b 1..787 1..787 3920 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2579490..2579788 485..783 1465 99.3 Plus
chr2R 21145070 chr2R 2579080..2579261 187..368 910 100 Plus
chr2R 21145070 chr2R 2578894..2579025 57..188 660 100 Plus
chr2R 21145070 chr2R 2579316..2579434 367..485 595 100 Plus
chr2R 21145070 chr2R 2563052..2563109 1..58 275 98.3 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:14:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG9422-RD 621 CG9422-PD 1..621 79..699 3105 100 Plus
CG9422-RC 621 CG9422-PC 1..621 79..699 3105 100 Plus
CG9422-RA 621 CG9422-PA 1..621 79..699 3105 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:21:55 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG9422-RC 1388 CG9422-RC 34..816 1..783 3900 99.9 Plus
CG9422-RA 816 CG9422-RA 34..816 1..783 3900 99.9 Plus
CG9422-RD 1310 CG9422-RD 585..1310 58..783 3630 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:14:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG9422-PD 206 CG9422-PD 1..206 79..696 929 100 Plus
CG9422-PC 206 CG9422-PC 1..206 79..696 929 100 Plus
CG9422-PA 206 CG9422-PA 1..206 79..696 929 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:14:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6692292..6692594 485..787 1515 100 Plus
2R 25286936 2R 6691882..6692063 187..368 910 100 Plus
2R 25286936 2R 6691696..6691827 57..188 660 100 Plus
2R 25286936 2R 6692118..6692236 367..485 595 100 Plus
2R 25286936 2R 6675855..6675912 1..58 275 98.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6693491..6693793 485..787 1515 100 Plus
2R 25260384 2R 6693081..6693262 187..368 910 100 Plus
2R 25260384 2R 6692895..6693026 57..188 660 100 Plus
2R 25260384 2R 6693317..6693435 367..485 595 100 Plus
2R 25260384 2R 6677054..6677111 1..58 275 98.2 Plus
Blast to na_te.dros performed 2014-11-27 14:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2455..2512 528..584 116 69 Plus

FI09323.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:08:06 Download gff for FI09323.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2579491..2579788 486..783 99   Plus
chr2R 2579318..2579434 369..485 100 -> Plus
chr2R 2579080..2579261 187..368 100 -> Plus
chr2R 2578896..2579023 59..186 100 -> Plus
chr2R 2563052..2563109 1..58 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:43:17 Download gff for FI09323.complete
Subject Subject Range Query Range Percent Splice Strand
CG9422-RC 1..621 79..699 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:01:04 Download gff for FI09323.complete
Subject Subject Range Query Range Percent Splice Strand
CG9422-RC 1..621 79..699 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:48:09 Download gff for FI09323.complete
Subject Subject Range Query Range Percent Splice Strand
CG9422-RA 1..621 79..699 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:08:06 Download gff for FI09323.complete
Subject Subject Range Query Range Percent Splice Strand
CG9422-RA 1..621 79..699 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:43:16 Download gff for FI09323.complete
Subject Subject Range Query Range Percent Splice Strand
CG9422-RC 1..783 1..783 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:01:04 Download gff for FI09323.complete
Subject Subject Range Query Range Percent Splice Strand
CG9422-RC 1..783 1..783 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:48:09 Download gff for FI09323.complete
Subject Subject Range Query Range Percent Splice Strand
CG9422-RA 34..816 1..783 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-12 15:54:54 Download gff for FI09323.complete
Subject Subject Range Query Range Percent Splice Strand
CG9422-RC 1..783 1..783 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:08:06 Download gff for FI09323.complete
Subject Subject Range Query Range Percent Splice Strand
CG9422-RA 34..816 1..783 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:08:06 Download gff for FI09323.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6692293..6692590 486..783 100   Plus
2R 6692120..6692236 369..485 100 -> Plus
2R 6691882..6692063 187..368 100 -> Plus
2R 6691698..6691825 59..186 100 -> Plus
2R 6675855..6675912 1..58 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:48:09 Download gff for FI09323.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2579798..2580095 486..783 100   Plus
arm_2R 2579625..2579741 369..485 100 -> Plus
arm_2R 2579387..2579568 187..368 100 -> Plus
arm_2R 2579203..2579330 59..186 100 -> Plus
arm_2R 2563360..2563417 1..58 98 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:28:19 Download gff for FI09323.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6693492..6693789 486..783 100   Plus
2R 6693319..6693435 369..485 100 -> Plus
2R 6693081..6693262 187..368 100 -> Plus
2R 6692897..6693024 59..186 100 -> Plus
2R 6677054..6677111 1..58 98 -> Plus

FI09323.pep Sequence

Translation from 78 to 698

> FI09323.pep
MMHYRKAENVEKELSKSDLPFEDCMPKSQKDFLWMHVKGGTKVSNVIEFA
QEALNKGEHRCVVWSGSGGGVVKTISCAEVLKRSHPLYQVTRMAYTSVEE
HWKPQMEGLEEIIVTRQIPTLHILMSLDELPDTIDGLQKPNTSTDFWDGG
GAQQQPHPRSQPRHQQQPHKPGAGRGGRPNKRTRPGRNKPGQQPEKPAAE
ENLPAS*

FI09323.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 22:24:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11065-PA 205 GF11065-PA 1..189 1..193 685 79.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 22:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23216-PA 202 GG23216-PA 1..202 1..206 848 80.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 22:24:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23366-PA 200 GH23366-PA 1..173 1..189 735 74.1 Plus
Dgri\GH21749-PA 200 GH21749-PA 1..147 1..147 723 88.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:24:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG9422-PD 206 CG9422-PD 1..206 1..206 1117 100 Plus
CG9422-PC 206 CG9422-PC 1..206 1..206 1117 100 Plus
CG9422-PA 206 CG9422-PA 1..206 1..206 1117 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 22:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19296-PA 212 GI19296-PA 1..187 1..190 741 73.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 22:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11113-PA 201 GL11113-PA 1..196 1..205 769 70.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 22:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21774-PA 201 GA21774-PA 1..196 1..205 773 71.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 22:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20892-PA 160 GM20892-PA 9..160 53..206 662 93.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 22:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10419-PA 204 GD10419-PA 1..204 1..206 973 94.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 22:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22173-PA 205 GJ22173-PA 1..175 1..190 697 70 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 22:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23087-PA 174 GK23087-PA 1..154 1..154 595 66.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 22:24:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19070-PA 206 GE19070-PA 1..206 1..206 908 84 Plus

FI09323.hyp Sequence

Translation from 78 to 698

> FI09323.hyp
MMHYRKAENVEKELSKSDLPFEDCMPKSQKDFLWMHVKGGTKVSNVIEFA
QEALNKGEHRCVVWSGSGGGVVKTISCAEVLKRSHPLYQVTRMAYTSVEE
HWKPQMEGLEEIIVTRQIPTLHILMSLDELPDTIDGLQKPNTSTDFWDGG
GAQQQPHPRSQPRHQQQPHKPGAGRGGRPNKRTRPGRNKPGQQPEKPAAE
ENLPAS*

FI09323.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:46:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG9422-PD 206 CG9422-PD 1..206 1..206 1117 100 Plus
CG9422-PC 206 CG9422-PC 1..206 1..206 1117 100 Plus
CG9422-PA 206 CG9422-PA 1..206 1..206 1117 100 Plus