Clone FI09332 Report

Search the DGRC for FI09332

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:93
Well:32
Vector:pFlc-1
Associated Gene/TranscriptNup43-RA
Protein status:FI09332.pep: gold
Sequenced Size:1208

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7671 2008-12-18 5.12 accounting

Clone Sequence Records

FI09332.complete Sequence

1208 bp assembled on 2008-09-15

GenBank Submission: BT044525.1

> FI09332.complete
ACTTAACTCGAAAGCCGCATTATTTTGTTTACATCGCGAATCCTCTGCTA
AATCCAACGAAAAGATGTCCATTGCAAACGTTTCCACGCACTACATATCC
GAGAAGGTGTCCCAAGTGCGCTGGCTTCCGGAGGAACTGCAGCAGAGCGA
ACGGTTCGTTACTGGAAGCTGGGACATGGACCAGAACTTCGTGCGCCTCT
GGCGGCTACAATCGAACCAATATGTCACCGCCACGGATTCGGAAGTGGAC
CAGATACCTCGCTGCATGGACAAGGTGAGAATGGAGGACGATGTGACCGC
CATGGAGTTCGTCGACAAGGACACGCTGGCTGTGAGCTGTGCCGATGGTC
ATCTCAGCGTGTTTAACGTCCATCGAGCCGTGGAGGAGGATCAGATGCAA
CGTACGTCCCGATCGGGACGTCTGCACTGCTTCCAACGTAGCCAGGAGCC
CGCTCCTTGCACCGACCTTTCTGTTTACGGCACGGATATCGCCACCGCCG
GCGAGGATGGGTGTGTAAGCATCGTCTCCGTGGAAAATGTGCGCCAGGTG
AAGCGACAGATTGAGGCGGACAGCATGGCGCTGTTTTCCATTTGCTATAT
CAGCCAGCAGGAACTGGTGACTGCCAATAGGATGGGTGTTATCCGAATGC
TGGACGCCCGAGTGGCCACTGAAGCGCAGCCGAAGACCACCTTTATGGTG
GCCTCCCAGGATGACAAGTCGAACTTTGTCTCGTCCCTTGCCAAGCATCC
GATGCAGCAACATATTTTACTTTGCGGCAGCGAAGAGGGTTCCATAACCG
TCTGGGATATGCGAAACCTCAGTTATCCCGCCTCCTATCTCAGCGCTCAC
AAAAGTCCCATCAACGAGATAGGCTTCCATCAAAAGGATCCCAGCAAACT
GTTCACCGCCGCAGAAGGTGGCGAGGTGTGGATGTGGTCAGAGAACAAAG
TTCTCGGGTGCGACTATAACAAAGACGGACACAGCCCCTGGTTGTCTGGC
GATCGTGTTCGCTCCCTGGTCGATGTGGAGGGAGTGCTGAGTAATGTTCG
CAAGTCCATCAACTCCTTCGATGTGCATGGAAGTCGTCTGGTCTGCGGAG
GCGACACAGAAGCCGTTTACCTAGTTGATAATATTGTTTAAATGTCAAGC
CTTTTGAATTCCTTACCTAAATTATATAATATTTCAATTGTTGAAAAAAA
AAAAAAAA

FI09332.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG7671-RA 1264 CG7671-RA 64..1259 1..1196 5980 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14191274..14192120 347..1193 4190 99.6 Plus
chr3R 27901430 chr3R 14190863..14191213 1..351 1650 98 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:38:28
Subject Length Description Subject Range Query Range Score Percent Strand
Nup43-RA 1077 CG7671-PA 1..1077 65..1141 5385 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:21:59 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
Nup43-RA 1211 CG7671-RA 19..1211 1..1193 5965 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:38:30
Subject Length Description Subject Range Query Range Score Percent Strand
Nup43-PA 358 CG7671-PA 1..358 65..1138 1869 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:38:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18367067..18367916 347..1196 4250 100 Plus
3R 32079331 3R 18366656..18367006 1..351 1755 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18107898..18108747 347..1196 4250 100 Plus
3R 31820162 3R 18107487..18107837 1..351 1755 100 Plus
Blast to na_te.dros performed on 2014-11-27 05:38:26 has no hits.

FI09332.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:39:43 Download gff for FI09332.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14191275..14192120 348..1193 99   Plus
chr3R 14190863..14191209 1..347 97 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:00:10 Download gff for FI09332.complete
Subject Subject Range Query Range Percent Splice Strand
CG7671-RA 1..1077 65..1141 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:01:28 Download gff for FI09332.complete
Subject Subject Range Query Range Percent Splice Strand
CG7671-RA 1..1077 65..1141 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:50:41 Download gff for FI09332.complete
Subject Subject Range Query Range Percent Splice Strand
Nup43-RA 1..1077 65..1141 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:39:43 Download gff for FI09332.complete
Subject Subject Range Query Range Percent Splice Strand
Nup43-RA 1..1077 65..1141 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:19:51 Download gff for FI09332.complete
Subject Subject Range Query Range Percent Splice Strand
CG7671-RA 1..1193 1..1193 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:01:28 Download gff for FI09332.complete
Subject Subject Range Query Range Percent Splice Strand
CG7671-RA 1..1193 1..1193 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:50:41 Download gff for FI09332.complete
Subject Subject Range Query Range Percent Splice Strand
Nup43-RA 19..1211 1..1193 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-15 12:13:43 Download gff for FI09332.complete
Subject Subject Range Query Range Percent Splice Strand
CG7671-RA 1..1193 1..1193 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:39:43 Download gff for FI09332.complete
Subject Subject Range Query Range Percent Splice Strand
Nup43-RA 19..1211 1..1193 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:39:43 Download gff for FI09332.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18367068..18367913 348..1193 100   Plus
3R 18366656..18367002 1..347 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:50:41 Download gff for FI09332.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14192790..14193635 348..1193 100   Plus
arm_3R 14192378..14192724 1..347 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:28:53 Download gff for FI09332.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18107899..18108744 348..1193 100   Plus
3R 18107487..18107833 1..347 100 -> Plus

FI09332.pep Sequence

Translation from 1 to 1140

> FI09332.pep
LNSKAALFCLHRESSAKSNEKMSIANVSTHYISEKVSQVRWLPEELQQSE
RFVTGSWDMDQNFVRLWRLQSNQYVTATDSEVDQIPRCMDKVRMEDDVTA
MEFVDKDTLAVSCADGHLSVFNVHRAVEEDQMQRTSRSGRLHCFQRSQEP
APCTDLSVYGTDIATAGEDGCVSIVSVENVRQVKRQIEADSMALFSICYI
SQQELVTANRMGVIRMLDARVATEAQPKTTFMVASQDDKSNFVSSLAKHP
MQQHILLCGSEEGSITVWDMRNLSYPASYLSAHKSPINEIGFHQKDPSKL
FTAAEGGEVWMWSENKVLGCDYNKDGHSPWLSGDRVRSLVDVEGVLSNVR
KSINSFDVHGSRLVCGGDTEAVYLVDNIV*

FI09332.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 22:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16901-PA 362 GF16901-PA 3..362 25..379 1500 76.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 22:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22870-PA 359 GG22870-PA 1..359 22..379 1825 93.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 22:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18341-PA 354 GH18341-PA 5..353 27..378 1302 66 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
Nup43-PA 358 CG7671-PA 1..358 22..379 1869 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 22:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23322-PA 353 GI23322-PA 5..353 27..378 1291 64.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 22:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24341-PA 356 GL24341-PA 1..355 22..378 1409 70.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 22:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20514-PA 356 GA20514-PA 1..355 22..378 1409 70.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 22:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17865-PA 358 GM17865-PA 1..358 22..379 1874 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 22:15:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19227-PA 358 GD19227-PA 1..358 22..379 1873 96.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 22:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10325-PA 353 GJ10325-PA 5..353 27..378 1304 66 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 22:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11598-PA 321 GK11598-PA 3..315 25..335 1183 64.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 22:15:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25534-PA 359 GE25534-PA 1..359 22..379 1838 94.7 Plus

FI09332.hyp Sequence

Translation from 1 to 1140

> FI09332.hyp
LNSKAALFCLHRESSAKSNEKMSIANVSTHYISEKVSQVRWLPEELQQSE
RFVTGSWDMDQNFVRLWRLQSNQYVTATDSEVDQIPRCMDKVRMEDDVTA
MEFVDKDTLAVSCADGHLSVFNVHRAVEEDQMQRTSRSGRLHCFQRSQEP
APCTDLSVYGTDIATAGEDGCVSIVSVENVRQVKRQIEADSMALFSICYI
SQQELVTANRMGVIRMLDARVATEAQPKTTFMVASQDDKSNFVSSLAKHP
MQQHILLCGSEEGSITVWDMRNLSYPASYLSAHKSPINEIGFHQKDPSKL
FTAAEGGEVWMWSENKVLGCDYNKDGHSPWLSGDRVRSLVDVEGVLSNVR
KSINSFDVHGSRLVCGGDTEAVYLVDNIV*

FI09332.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
Nup43-PA 358 CG7671-PA 1..358 22..379 1869 100 Plus