Clone FI09530 Report

Search the DGRC for FI09530

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:95
Well:30
Vector:pFlc-1
Associated Gene/TranscriptCG32302-RA
Protein status:FI09530.pep: gold
Sequenced Size:1094

Clone Sequence Records

FI09530.complete Sequence

1094 bp assembled on 2009-10-06

GenBank Submission: BT099960.1

> FI09530.complete
AACAGTCTTCAAGATGAGGTCTTCAGTACCGGTTTGTCTAATCCTGCTCG
CTCTGGCGTTGGGATCGGCGTGGGCTAATGATAATCCCTGCCAGGATGTG
CGCATTCCCGGCTTCGTTTGCATGAACTGCACCACCTTGGGCTACTGCAT
CCGCGATGCCACCGGCAGCTGGGAAACGATTTCGATGCTGGGCTGCCAAT
CGGAGTACAATTTCTATTGCAGCGACGAGGGTACCTTCGGATGCACCTTC
CAGTCGCAGTGCCAGGTGCCCAAGAGAGGTCCCTTCAGCTGTCAGCAGGC
GGGCCTGTTCCCGGATCCGTACGACTGTAGGCGGTACCACGAGTGCAGCG
ATCAGAGTGTGGACACCCCTCGCATCTGCTCCAACGGAGCGGGCTACTCC
ACACTCACGGGCACTTGTGTTCTGCCACGGGAGAGTGAGCAGTGCATCCA
GGAGCAGTTCACCTGCAGTCGGTCGGGACAAGTGGGTGGATGGGCGCCCG
ACAATCGGTACTTCTACGTCTGCGTCAATGACACGGCCAATTCGCTGTAT
CCGCTGATGATGAAGTGCCACGAGGGATTCGTTTTCAACAGCTACAGCTG
TGTGCCCGACACCAGGAGCATGAGGAGCATTCAGGCGATGGAGTCCCACA
CGTGCATGAACAACGATAGGTACCAATGCCCCTTCCGAACCTCTGAGATC
GAGTACTGCAAGTGCGTCGATGGAGAACTGGAGGTGATGACCTGTCCCGC
CGGCTTCCAAATTGATCCTAAGATCCTGACCTGCGTGACTGATAGGATCT
ATCAGTGCTCGGACTTTGAGATCCTCAGCTGTCCCAATGTCTCCACCAAG
GATGAGTACTGCATATGCATCGATCACCAGCTGCAGATCTACAGCTGTCC
AATGGGACAGTATTTCAATGCTGAGACTCGAAAGTGCCAATCAGAGTCAG
AGTAATGAATTGTTTTCATGGTACCAATATTGATTCAAGTAAATGCCTAT
TTAAAAAAATTGAAATCATTCTGAACATTTTAAGATAAACTACAAATAAC
TATAAATATTCACCAAAATTTTAATGAGAAAAAAAAAAAAAAAA

FI09530.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG32302-RA 1077 CG32302-RA 1..1077 1..1078 5350 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2268233..2269309 1..1078 5250 99.4 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG32302-RA 942 CG32302-PA 1..942 14..955 4710 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:22:10 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG32302-RA 1079 CG32302-RA 3..1079 1..1078 5340 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG32302-PA 313 CG32302-PA 1..313 14..952 1761 100 Plus
CG13806-PA 297 CG13806-PA 1..293 5..787 304 28.5 Plus
obst-I-PA 219 CG32304-PA 38..154 596..937 177 31.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:22:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2268827..2269904 1..1079 5345 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2268827..2269904 1..1079 5355 99.9 Plus
Blast to na_te.dros performed on 2014-11-27 15:22:04 has no hits.

FI09530.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:10:20 Download gff for FI09530.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2268233..2269309 1..1078 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:50 Download gff for FI09530.complete
Subject Subject Range Query Range Percent Splice Strand
CG32302-RA 1..942 14..955 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:41:16 Download gff for FI09530.complete
Subject Subject Range Query Range Percent Splice Strand
CG32302-RA 1..942 14..955 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:12:51 Download gff for FI09530.complete
Subject Subject Range Query Range Percent Splice Strand
CG32302-RA 1..942 14..955 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:10:20 Download gff for FI09530.complete
Subject Subject Range Query Range Percent Splice Strand
CG32302-RA 1..942 14..955 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-06 14:14:56 Download gff for FI09530.complete
Subject Subject Range Query Range Percent Splice Strand
CG32302-RA 1..1011 1..1012 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:41:16 Download gff for FI09530.complete
Subject Subject Range Query Range Percent Splice Strand
CG32302-RA 1..1077 1..1078 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:12:51 Download gff for FI09530.complete
Subject Subject Range Query Range Percent Splice Strand
CG32302-RA 3..1079 1..1078 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:10:20 Download gff for FI09530.complete
Subject Subject Range Query Range Percent Splice Strand
CG32302-RA 3..1079 1..1078 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:10:20 Download gff for FI09530.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2268827..2269903 1..1078 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:12:51 Download gff for FI09530.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2268827..2269903 1..1078 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:22:55 Download gff for FI09530.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2268827..2269903 1..1078 99   Plus

FI09530.pep Sequence

Translation from 1 to 954

> FI09530.pep
TVFKMRSSVPVCLILLALALGSAWANDNPCQDVRIPGFVCMNCTTLGYCI
RDATGSWETISMLGCQSEYNFYCSDEGTFGCTFQSQCQVPKRGPFSCQQA
GLFPDPYDCRRYHECSDQSVDTPRICSNGAGYSTLTGTCVLPRESEQCIQ
EQFTCSRSGQVGGWAPDNRYFYVCVNDTANSLYPLMMKCHEGFVFNSYSC
VPDTRSMRSIQAMESHTCMNNDRYQCPFRTSEIEYCKCVDGELEVMTCPA
GFQIDPKILTCVTDRIYQCSDFEILSCPNVSTKDEYCICIDHQLQIYSCP
MGQYFNAETRKCQSESE*

FI09530.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24910-PA 342 GF24910-PA 1..326 5..317 960 53.8 Plus
Dana\GF24908-PA 299 GF24908-PA 12..295 5..262 267 27.6 Plus
Dana\GF24909-PA 217 GF24909-PA 35..101 247..313 147 35.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14854-PA 313 GG14854-PA 1..312 5..317 1510 89.5 Plus
Dere\GG14852-PA 297 GG14852-PA 5..293 4..262 259 28.4 Plus
Dere\GG14853-PA 217 GG14853-PA 38..154 188..312 155 27.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16471-PA 280 GH16471-PA 28..268 17..255 588 47.1 Plus
Dgri\GH16470-PA 296 GH16470-PA 37..292 30..262 257 27.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG32302-PA 313 CG32302-PA 1..313 5..317 1761 100 Plus
CG13806-PA 297 CG13806-PA 1..293 2..262 304 28.5 Plus
obst-I-PA 219 CG32304-PA 38..154 199..312 177 31.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12143-PA 266 GI12143-PA 23..266 19..265 637 50 Plus
Dmoj\GI12142-PA 300 GI12142-PA 37..285 30..251 245 26.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24645-PA 344 GL24645-PA 27..293 20..287 732 50 Plus
Dper\GL24644-PA 297 GL24644-PA 36..293 28..262 266 29.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16817-PA 344 GA16817-PA 27..293 20..287 741 50.7 Plus
Dpse\GA12542-PA 297 GA12542-PA 36..293 28..262 266 29.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14480-PA 312 GM14480-PA 1..312 5..317 1566 93.6 Plus
Dsec\GM14477-PA 297 GM14477-PA 35..293 28..262 260 28.3 Plus
Dsec\GM14479-PA 219 GM14479-PA 38..154 199..312 169 32.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:02:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13676-PA 312 GD13676-PA 1..312 5..317 1585 94.6 Plus
Dsim\GD13674-PA 297 GD13674-PA 1..293 2..262 264 27.8 Plus
Dsim\GD13675-PA 219 GD13675-PA 38..154 199..312 169 32.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13422-PA 370 GJ13422-PA 22..321 13..317 676 45.2 Plus
Dvir\GJ13421-PA 295 GJ13421-PA 37..291 30..262 248 26.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12632-PA 214 GK12632-PA 1..214 5..201 580 51.2 Plus
Dwil\GK12631-PA 301 GK12631-PA 38..297 30..262 254 26.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20311-PA 313 GE20311-PA 1..312 5..317 1520 89.5 Plus
Dyak\GE20309-PA 297 GE20309-PA 35..293 28..262 257 29.1 Plus
Dyak\GE20310-PA 202 GE20310-PA 22..137 189..312 166 28.2 Plus

FI09530.hyp Sequence

Translation from 1 to 954

> FI09530.hyp
TVFKMRSSVPVCLILLALALGSAWANDNPCQDVRIPGFVCMNCTTLGYCI
RDATGSWETISMLGCQSEYNFYCSDEGTFGCTFQSQCQVPKRGPFSCQQA
GLFPDPYDCRRYHECSDQSVDTPRICSNGAGYSTLTGTCVLPRESEQCIQ
EQFTCSRSGQVGGWAPDNRYFYVCVNDTANSLYPLMMKCHEGFVFNSYSC
VPDTRSMRSIQAMESHTCMNNDRYQCPFRTSEIEYCKCVDGELEVMTCPA
GFQIDPKILTCVTDRIYQCSDFEILSCPNVSTKDEYCICIDHQLQIYSCP
MGQYFNAETRKCQSESE*

FI09530.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG32302-PA 313 CG32302-PA 1..313 5..317 1761 100 Plus
CG13806-PA 297 CG13806-PA 1..293 2..262 304 28.5 Plus
obst-I-PA 219 CG32304-PA 38..154 199..312 177 31.6 Plus