Clone FI10981 Report

Search the DGRC for FI10981

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:109
Well:81
Vector:pOT2
Associated Gene/TranscriptCG42542-RG
Protein status:FI10981.pep: gold
Sequenced Size:1572

Clone Sequence Records

FI10981.complete Sequence

1572 bp assembled on 2009-06-18

GenBank Submission: BT088832.1

> FI10981.complete
CCTTTATGCAACACGAAATTAAAACAATTCGATAATAACGTTGCCCCTCA
AAATGTTACCGAAACAAACATAAACTATATATGTTGCACTCAACTTTGAT
TTGTGCCACGCTCCAAGCGCAGTTACTGCGCAAGGCCAGCCGCAAGTACG
AGGACGCGGAGGGCAAGCGAAAGAATAGCAACTCGGACAAGGAGGATGCC
AGCGAACAGGCGCTTATCCATGGCCGCAACTCCATTTCCACGGCGGCAGG
TTCCACCACGGACATGCAGCATCGCCAGCGGAAACAGCGCAATCATCTCA
ATAACAATAATAGTAAGCAAAATAGCTGTGATAAAACTGGCAACGATGAC
GACGACCGGGATCAGCACGAATCGGAGGTGTTCCTCAAGGAGGGCGGCCG
CATTGTCGAGCAGCTCAAGTTAAAGACCTTCCCCAGCAGCCCGGCCCACT
CGGCGGCCTCATCGAACCAGACCGAACAAACCAACTCTATTGCCGCCTCC
ACCGCCACCGTAGATGTCCAGCTGGCTGGCCATCCCACCGACCCGTCCGT
AGGTGGCGCCTCGGAGCCACGTGCTCCGCTGGCCGGACACGATAGCATGC
ACAGTCTCAATGGCAGCCTAAACGGAGAATCCGGACCGGTGAATGGCGCT
CTCAAAGCACGGCTGGATCGTGATGTGAACGCGGCGCTGGTGAATGACGC
CGAGAGCGGTCGTCGTCGTCCACAGAAACGGGGTGCCACCTACTTCACCA
TGCGCATCCTGGCCCAGGCCTTCACAATGACGTTCCTGGCCGAGTGGGGC
GATCGCTCCCAACTGACCACCATTATTCTCGCCGCTAGCAAGGACGTTTA
CGGCGTTATCGCTGGCGGTATTATTGGCCACTGCATCTGCACCGGCCTGG
CTGTGATTGGTGGTCGTCTCGTGGCTTCCAAAATCTCAGTGCGCACTGTC
ACCATTGTGGGTGGCATTGTGTTCATCGGATTCGCCATCTACGCTGTCGC
CATACCTCCGGATGACATTTAGGCGAAGCCTTTATACTCCAATCGAGATT
GCCCGCTGACGACCCCACAATATTATGAAGATTTAGTTTTAGTTACTACC
TGATAAACCCCACTTTTCTTCGAGGAGCATCAGGCAAGGATCGTGTTGAA
CTAGTTTAAAACTAGAAATGCGTTGATGTTTTTAACGTAGCTTTCTTCTT
GCCAAACATCCAAAACAAAAGTGCCTTCAGTGCTTTCCGCTTCGGCCATG
ACATACATTTTTAGTTCACACAATTAATTCTTTTGTTTTCCAATTGTCTA
GTATCGCTTTAATTTGTTTGTTTAGTTTCGGTTTCGTGTTAAGTATTAAA
GATGATTGTACATACGCGTGTAGAGCCATCGCGATGCCCACGCTCCTCTG
AGTTGTATCCTTTCCTTCATAACGCAGATCCTTATTCGCATATTTGTTTA
CGTAGCCGTGTTTACTTAATGGAAACAACCAAAATGAAACTTTGTAGATT
TGATTATTTATGCGAATTTTGTATGAAAAACTAATTAAATTGAGCAAAAC
AAAAAAAAAAAAAAAAAAAAAA

FI10981.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:32:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG42542-RG 1578 CG42542-RG 1..1553 1..1553 7765 100 Plus
CG42542-RE 2276 CG42542-RE 817..2249 121..1553 7165 100 Plus
CG42542-RD 2258 CG42542-RD 801..2233 121..1553 7165 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:39:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11026895..11027604 841..1550 3520 99.7 Plus
chr3R 27901430 chr3R 11025195..11025856 1..662 3310 100 Plus
chr3R 27901430 chr3R 11026654..11026835 662..843 910 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG42542-RG 942 CG42542-PG 1..942 81..1022 4710 100 Plus
CG42542-RD 1512 CG42542-PD 611..1512 121..1022 4510 100 Plus
CG42542-RE 1512 CG42542-PE 611..1512 121..1022 4510 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:22:51 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG42542-RG 1550 CG42542-RG 1..1550 1..1550 7750 100 Plus
CG42542-RD 2215 CG42542-RD 782..2211 121..1550 7150 100 Plus
CG42542-RE 2190 CG42542-RE 757..2186 121..1550 7150 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG42542-PG 313 CG42542-PG 1..313 81..1019 1321 100 Plus
CG42542-PD 503 CG42542-PD 204..503 120..1019 1253 99.7 Plus
CG42542-PE 503 CG42542-PE 204..503 120..1019 1253 99.7 Plus
CG42542-PF 323 CG42542-PF 205..323 663..1019 520 100 Plus
CG42542-PC 323 CG4196-PB 205..323 663..1019 520 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15202264..15202976 841..1553 3565 100 Plus
3R 32079331 3R 15200564..15201225 1..662 3310 100 Plus
3R 32079331 3R 15202023..15202204 662..843 910 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14943095..14943807 841..1553 3565 100 Plus
3R 31820162 3R 14941395..14942056 1..662 3310 100 Plus
3R 31820162 3R 14942854..14943035 662..843 910 100 Plus
Blast to na_te.dros performed 2014-11-27 03:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
TART-A 13424 TART-A 13424bp 8115..8199 1315..1232 126 64.4 Minus
G7 1192 G7 G7 1192bp 1117..1190 1319..1248 122 64.9 Minus

FI10981.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:17:07 Download gff for FI10981.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11026897..11027604 843..1550 99   Plus
chr3R 11026655..11026834 663..842 100 -> Plus
chr3R 11025195..11025856 1..662 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:40 Download gff for FI10981.complete
Subject Subject Range Query Range Percent Splice Strand
CG31303-RA 1..582 81..662 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:48:09 Download gff for FI10981.complete
Subject Subject Range Query Range Percent Splice Strand
CG42542-RG 1..942 81..1022 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:45:45 Download gff for FI10981.complete
Subject Subject Range Query Range Percent Splice Strand
CG42542-RG 1..942 81..1022 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:17:07 Download gff for FI10981.complete
Subject Subject Range Query Range Percent Splice Strand
CG42542-RG 1..942 81..1022 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-18 17:14:24 Download gff for FI10981.complete
Subject Subject Range Query Range Percent Splice Strand
CG4196-RB 795..1690 656..1550 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:48:09 Download gff for FI10981.complete
Subject Subject Range Query Range Percent Splice Strand
CG42542-RG 1..1550 1..1550 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:45:45 Download gff for FI10981.complete
Subject Subject Range Query Range Percent Splice Strand
CG42542-RG 1..1550 1..1550 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:17:07 Download gff for FI10981.complete
Subject Subject Range Query Range Percent Splice Strand
CG42542-RG 1..1550 1..1550 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:17:07 Download gff for FI10981.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15202266..15202973 843..1550 100   Plus
3R 15202024..15202203 663..842 100 -> Plus
3R 15200564..15201225 1..662 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:45:45 Download gff for FI10981.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11027988..11028695 843..1550 100   Plus
arm_3R 11027746..11027925 663..842 100 -> Plus
arm_3R 11026286..11026947 1..662 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:23:42 Download gff for FI10981.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14943097..14943804 843..1550 100   Plus
3R 14942855..14943034 663..842 100 -> Plus
3R 14941395..14942056 1..662 100 -> Plus

FI10981.pep Sequence

Translation from 80 to 1021

> FI10981.pep
MLHSTLICATLQAQLLRKASRKYEDAEGKRKNSNSDKEDASEQALIHGRN
SISTAAGSTTDMQHRQRKQRNHLNNNNSKQNSCDKTGNDDDDRDQHESEV
FLKEGGRIVEQLKLKTFPSSPAHSAASSNQTEQTNSIAASTATVDVQLAG
HPTDPSVGGASEPRAPLAGHDSMHSLNGSLNGESGPVNGALKARLDRDVN
AALVNDAESGRRRPQKRGATYFTMRILAQAFTMTFLAEWGDRSQLTTIIL
AASKDVYGVIAGGIIGHCICTGLAVIGGRLVASKISVRTVTIVGGIVFIG
FAIYAVAIPPDDI*

FI10981.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17836-PA 510 GF17836-PA 205..510 14..313 1295 83.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16892-PA 510 GG16892-PA 204..510 14..313 1486 94.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18975-PA 507 GH18975-PA 204..507 14..313 923 64.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG42542-PG 313 CG42542-PG 1..313 1..313 1592 100 Plus
CG42542-PD 503 CG42542-PD 204..503 14..313 1524 99.7 Plus
CG42542-PE 503 CG42542-PE 204..503 14..313 1524 99.7 Plus
CG42542-PF 323 CG42542-PF 205..323 195..313 597 100 Plus
CG42542-PC 323 CG4196-PB 205..323 195..313 597 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24136-PA 512 GI24136-PA 206..509 14..313 979 63.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:35:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22139-PA 518 GL22139-PA 206..518 14..313 1083 74.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:35:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27390-PA 518 GA27390-PA 206..518 14..313 1088 74.1 Plus
Dpse\GA27390-PB 326 GA27390-PB 207..326 195..313 582 92.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:35:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24201-PA 503 GM24201-PA 204..503 14..313 1577 98 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:35:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18991-PA 503 GD18991-PA 204..503 14..313 1584 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10960-PA 505 GJ10960-PA 204..505 14..313 942 63.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13301-PA 527 GK13301-PA 203..524 14..313 1045 67.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24274-PA 504 GE24274-PA 204..504 14..313 1404 91.9 Plus

FI10981.hyp Sequence

Translation from 80 to 1021

> FI10981.hyp
MLHSTLICATLQAQLLRKASRKYEDAEGKRKNSNSDKEDASEQALIHGRN
SISTAAGSTTDMQHRQRKQRNHLNNNNSKQNSCDKTGNDDDDRDQHESEV
FLKEGGRIVEQLKLKTFPSSPAHSAASSNQTEQTNSIAASTATVDVQLAG
HPTDPSVGGASEPRAPLAGHDSMHSLNGSLNGESGPVNGALKARLDRDVN
AALVNDAESGRRRPQKRGATYFTMRILAQAFTMTFLAEWGDRSQLTTIIL
AASKDVYGVIAGGIIGHCICTGLAVIGGRLVASKISVRTVTIVGGIVFIG
FAIYAVAIPPDDI*

FI10981.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG42542-PG 313 CG42542-PG 1..313 1..313 1592 100 Plus
CG42542-PD 503 CG42542-PD 204..503 14..313 1524 99.7 Plus
CG42542-PE 503 CG42542-PE 204..503 14..313 1524 99.7 Plus
CG42542-PF 323 CG42542-PF 205..323 195..313 597 100 Plus
CG42542-PC 323 CG4196-PB 205..323 195..313 597 100 Plus