Clone FI11059 Report

Search the DGRC for FI11059

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:110
Well:59
Vector:pOT2
Associated Gene/TranscriptCG4553-RA
Protein status:FI11059.pep: gold
Sequenced Size:1301

Clone Sequence Records

FI11059.complete Sequence

1301 bp assembled on 2010-03-25

GenBank Submission: BT125994.1

> FI11059.complete
CGGTTTGCATGCGGCTGTTTATGTAAACAAAAAGTTTAAATGACTTAAAA
TTGTTCACCAAGATGACTGCCCGCATGATCCAACGCGGCCTGCACACTGC
TCGCTCCTGTCTGTTGGCGAGAGCTCCTCGTCGCGCAAATCCTGGACTAG
GTTACCAGCTGGAGCAGCTGCAGGAGCACCCGGAAAAGAGCAGCGAAGCT
AGCGAGGATTACGCCGATCTGGAGTCGGATTTCATGGACGTGCAGAAGAC
CCATCGGCAGTACGAGAGGGAGCAGCAGCAGCATCGCGACCGCATCCGTC
AGTTTATGATAAAGCACAAGTATTTCCGAGACGCCAAGTTGCCCAATCTC
TTGCTTCATGCCGAAAAGGAGCAGATGCGCCTGCTGCACGAGCGAGATCC
CGAGGAATGGAGCGTTGAGCGATTGGCCGAAAGTTTTCCCGCCACTCCGG
ACATTGTGCAGAAAATTCTGCGGGCCAAGTGGCGACCGAGAAGTGTGCAA
AGGATACGCTCCCACGATGAAACCGTCATTAAAAACTGGCAGCTTTTAGG
GACGGGAAAGGGTGACTTCAGTATCCCACCGTCTCTTCTCCAGCATCTGC
AGAAATTCGCCGAGCGAAGGTGGCAGGATCTGCGGGAGCTTAAAATCCAG
GATTGGCCCACAAAATCACAACTACCGACTCCGCAAGGCAACGAATTCCG
CAAACTGCTGGGCAGCAGTAGTAAAACAACAGAGGAGATGCCTACACCAC
AAATCCCATCCGGCTATGAAGCTCCACCCTCTGCTGCCGAAGATGAAACC
TATTTGTTGGACAAAATCCGTAATAAAAAGAAGATGCGGCTGCAGGAGCT
TAAGGAATTGCAGCTCGTTGAGTCTGCGCCCGCAGTTCCAGAGGAAATGA
AGCGGCCCATCGAGAATCCCAGTGGCACCGGATTCCTGCCCAGTTTCGTG
CCCAAGTTTGCGAGCAGCGAGATTGTGATCAGTGCCGCGGATCAGCGCAA
GTATGAAATAACCCAGGTGAAAACACGCATTGTTATTCCCCGGAAACTGC
ATCGCCAAGGAGCCACTTACCGGGTGGAGGATGCCTATTACGATGACGAT
GGAGAGCTGCTCTACCGAGTGCCTGGAATGACCAGAGCCAGTGGTGATAA
ATAGCAAATGCCACTTTTAGGTAATATTTATTCGAAAAGAGCATTGTTTA
AATTGTAAATTTCGAAAATTGTTAATCACAAGCTTTGTCATCATTGTTTT
GTATAAAAATATATAAAACATTTGATACACAGAAAAAAAAAAAAAAAAAA
A

FI11059.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG4553-RA 1280 CG4553-RA 1..1280 1..1280 6400 100 Plus
Vps33B-RA 2203 Vps33B-RA 2079..2203 1283..1159 625 100 Minus
MED28.a 724 MED28.a 1..69 1139..1071 345 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:26:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21298763..21300044 1282..1 6380 99.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG4553-RA 1092 CG4553-PA 1..1092 63..1154 5460 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:22:56 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:26:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG4553-RA 1280 CG4553-RA 1..1280 1..1280 6400 100 Plus
Vps33B-RA 2091 CG5127-RA 1969..2091 1282..1160 615 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:26:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG4553-PA 363 CG4553-PA 1..363 63..1151 1798 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:26:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25475633..25476915 1283..1 6415 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25216464..25217746 1283..1 6415 100 Minus
Blast to na_te.dros performed on 2014-11-26 20:26:00 has no hits.

FI11059.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:28:48 Download gff for FI11059.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21298763..21300044 1..1282 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-25 11:35:24 Download gff for FI11059.complete
Subject Subject Range Query Range Percent Splice Strand
CG4553-RA 1..1092 63..1154 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:57:46 Download gff for FI11059.complete
Subject Subject Range Query Range Percent Splice Strand
CG4553-RA 1..1092 63..1154 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:04:32 Download gff for FI11059.complete
Subject Subject Range Query Range Percent Splice Strand
CG4553-RA 1..1092 63..1154 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:28:48 Download gff for FI11059.complete
Subject Subject Range Query Range Percent Splice Strand
CG4553-RA 1..1092 63..1154 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-25 11:35:23 Download gff for FI11059.complete
Subject Subject Range Query Range Percent Splice Strand
CG4553-RA 1..1154 1..1154 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:57:45 Download gff for FI11059.complete
Subject Subject Range Query Range Percent Splice Strand
CG4553-RA 1..1280 1..1280 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:04:32 Download gff for FI11059.complete
Subject Subject Range Query Range Percent Splice Strand
CG4553-RA 1..1280 1..1280 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:28:48 Download gff for FI11059.complete
Subject Subject Range Query Range Percent Splice Strand
CG4553-RA 1..1280 1..1280 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:28:48 Download gff for FI11059.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25475634..25476915 1..1282 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:04:32 Download gff for FI11059.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21301356..21302637 1..1282 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:34:35 Download gff for FI11059.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25216465..25217746 1..1282 100   Minus

FI11059.pep Sequence

Translation from 62 to 1153

> FI11059.pep
MTARMIQRGLHTARSCLLARAPRRANPGLGYQLEQLQEHPEKSSEASEDY
ADLESDFMDVQKTHRQYEREQQQHRDRIRQFMIKHKYFRDAKLPNLLLHA
EKEQMRLLHERDPEEWSVERLAESFPATPDIVQKILRAKWRPRSVQRIRS
HDETVIKNWQLLGTGKGDFSIPPSLLQHLQKFAERRWQDLRELKIQDWPT
KSQLPTPQGNEFRKLLGSSSKTTEEMPTPQIPSGYEAPPSAAEDETYLLD
KIRNKKKMRLQELKELQLVESAPAVPEEMKRPIENPSGTGFLPSFVPKFA
SSEIVISAADQRKYEITQVKTRIVIPRKLHRQGATYRVEDAYYDDDGELL
YRVPGMTRASGDK*

FI11059.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:04:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18083-PA 363 GF18083-PA 1..357 1..357 1423 76.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:04:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12245-PA 360 GG12245-PA 1..360 1..360 1778 93.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:05:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18229-PA 361 GH18229-PA 1..353 1..357 1085 64.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:04:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG4553-PA 363 CG4553-PA 1..363 1..363 1891 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10183-PA 330 GI10183-PA 1..326 29..357 1099 64.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:05:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12504-PA 361 GL12504-PA 1..357 1..356 1374 75 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:05:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18252-PA 361 GA18252-PA 1..357 1..356 1377 75 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10242-PA 363 GM10242-PA 1..363 1..363 1747 95.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:05:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18196-PA 363 GD18196-PA 1..363 1..363 1851 95.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10885-PA 355 GJ10885-PA 1..351 1..357 1169 67.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12001-PA 377 GK12001-PA 10..374 8..361 1150 65.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10694-PA 363 GE10694-PA 1..363 1..363 1790 93.4 Plus

FI11059.hyp Sequence

Translation from 62 to 1153

> FI11059.hyp
MTARMIQRGLHTARSCLLARAPRRANPGLGYQLEQLQEHPEKSSEASEDY
ADLESDFMDVQKTHRQYEREQQQHRDRIRQFMIKHKYFRDAKLPNLLLHA
EKEQMRLLHERDPEEWSVERLAESFPATPDIVQKILRAKWRPRSVQRIRS
HDETVIKNWQLLGTGKGDFSIPPSLLQHLQKFAERRWQDLRELKIQDWPT
KSQLPTPQGNEFRKLLGSSSKTTEEMPTPQIPSGYEAPPSAAEDETYLLD
KIRNKKKMRLQELKELQLVESAPAVPEEMKRPIENPSGTGFLPSFVPKFA
SSEIVISAADQRKYEITQVKTRIVIPRKLHRQGATYRVEDAYYDDDGELL
YRVPGMTRASGDK*

FI11059.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG4553-PA 363 CG4553-PA 1..363 1..363 1891 100 Plus