Clone FI11086 Report

Search the DGRC for FI11086

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:110
Well:86
Vector:pOT2
Associated Gene/TranscriptCG6999-RA
Protein status:FI11086.pep: gold
Sequenced Size:870

Clone Sequence Records

FI11086.complete Sequence

870 bp assembled on 2009-11-04

GenBank Submission: BT100266.1

> FI11086.complete
TACATTACAAAATATATTCGATCCAGCTAAAACGAAAGCTACAATGAAAA
AAATAATTAATACATCAAAGCCAAAGCGCAAGTCCACTTCCATGAAAGTG
GAGGAGACTAAGCTAGACGAGGCGCGCTGGGGTAAGCCGCAGACAAAGGA
AGGTGAGTCTGCAAATGGGATAGCAAATCCCTCAAATGACGATAAAAAGG
AGCTGGCCAATTTCAAAGCCACCTTCAATTCCTGGGCCCCCGAGAAGAAA
CGCGAGAAGATGCACAAGGTAGGCGTCATCTTAATATCCAACATACCCAA
GGACATGGACGGGGACTGCCTGAAGGAAATCATGAACTTGCACAGCGTCG
TCGGCAGAGTTTACGTGCAGCCGGAAACGCTGTCAAGTTTCAAGACAAAG
AAGAACATGCGTAAGGGCTGGGTGGAGTTCATTTCGAAAAGTGGGGCCAA
AAAAATCGCTCTAGAGCTGAACAATAAGCCTATAACCGATGGCAAGTCGT
CCCGATTCCGTGGCTTGCTGTGGAAAATGAAGTTCCTGCCACGCTTCAAG
TGGTACTATCTAACCGATCGCATGGACTACGAGCTGGCGGTTTGCAAAGT
TCGCGTATGGTCGCAGGCCCGCAAGCGGGCCACCTTCTGGTACGATCCCG
ACCAGATGGAGTATTTCAAGAAGCAAGTGAAGAAGATGAAGAAGATGAAG
AAGGTCAAGGAAGCGGAGATGGCTACCAGGAATGCGGAGATGGCTGCCAA
GAAAGCGGAGATGGCTGCCAAGAAATTGAAGAAGTCTGCCTGAGTTCACG
CTAGACCTTTGCTTCCAATGTCTACCTGACTGCAAATATACTTCAATAAA
GTAAAAAAAAAAAAAAAAAA

FI11086.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:42:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG6999-RA 875 CG6999-RA 14..868 1..855 4275 100 Plus
CG32706-RA 1003 CG32706-RA 153..854 1..702 3390 98.8 Plus
CG32706-RA 1003 CG32706-RA 830..998 687..855 815 98.8 Plus
CG32708-RA 915 CG32708-RA 96..257 31..192 390 82.7 Plus
CG32708-RA 915 CG32708-RA 494..672 414..592 355 79.8 Plus
CG32708-RA 915 CG32708-RA 332..471 276..415 235 77.8 Plus
CG32708-RA 915 CG32708-RA 822..901 787..866 205 83.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:16:39
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8980647..8981112 387..852 2330 100 Plus
chrX 22417052 chrX 8979420..8979876 387..852 2115 97.4 Plus
chrX 22417052 chrX 8980188..8980575 1..388 1940 100 Plus
chrX 22417052 chrX 8978961..8979348 1..388 1865 98.7 Plus
chrX 22417052 chrX 8977780..8978128 31..388 520 77.6 Plus
chrX 22417052 chrX 8978256..8978434 414..592 355 79.9 Plus
chrX 22417052 chrX 13681623..13681815 220..31 225 75.6 Minus
chrX 22417052 chrX 8978584..8978640 787..843 195 89.5 Plus
chrU 10048995 chrU 3136357..3136477 133..250 195 79.3 Plus
chrU 10048995 chrU 5467128..5467248 133..250 195 79.3 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:16:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG6999-RA 702 CG6999-PA 1..702 92..793 3510 100 Plus
CG32706-RA 693 CG32706-PA 1..693 92..793 3235 97.7 Plus
CG32708-RA 720 CG32708-PA 1..363 44..415 515 77.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:23:00 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:16:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG6999-RA 875 CG6999-RA 14..865 1..852 4260 100 Plus
CG32706-RA 872 CG32706-RA 25..867 1..852 3970 98 Plus
CG32708-RA 855 CG32708-RA 41..416 31..415 550 77.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:16:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG6999-PA 233 CG6999-PA 1..214 92..733 1054 100 Plus
CG32706-PA 230 CG32706-PA 1..211 92..733 1000 94.4 Plus
CG32708-PA 239 CG32708-PA 1..207 44..640 526 56.9 Plus
CG41562-PA 213 CG41562-PA 1..170 44..580 342 46.1 Plus
CG40813-PB 213 CG40813-PB 1..170 44..580 342 46.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:16:32
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9088839..9089307 387..855 2345 100 Plus
X 23542271 X 9087612..9088071 387..855 2130 97.4 Plus
X 23542271 X 9088380..9088767 1..388 1940 100 Plus
X 23542271 X 9087153..9087540 1..388 1865 98.7 Plus
X 23542271 X 9085972..9086320 31..388 505 77.3 Plus
X 23542271 X 9086448..9086626 414..592 355 79.9 Plus
X 23542271 X 13790894..13791086 220..31 225 75.6 Minus
X 23542271 X 9086776..9086855 787..866 205 83.8 Plus
X 23542271 X 22143179..22143299 133..250 195 79.3 Plus
X 23542271 X 22147910..22148030 133..250 195 79.3 Plus
X 23542271 X 22152963..22153083 133..250 195 79.3 Plus
X 23542271 X 22158008..22158128 133..250 195 79.3 Plus
X 23542271 X 22167776..22167896 133..250 195 79.3 Plus
X 23542271 X 22187491..22187611 133..250 195 79.3 Plus
X 23542271 X 22192394..22192514 133..250 195 79.3 Plus
X 23542271 X 22197295..22197415 133..250 195 79.3 Plus
X 23542271 X 22202304..22202424 133..250 195 79.3 Plus
X 23542271 X 22212449..22212569 133..250 195 79.3 Plus
X 23542271 X 22217500..22217620 133..250 195 79.3 Plus
X 23542271 X 22226694..22226814 133..250 195 79.3 Plus
X 23542271 X 22231691..22231811 133..250 195 79.3 Plus
X 23542271 X 22236686..22236806 133..250 195 79.3 Plus
X 23542271 X 22241693..22241813 133..250 195 79.3 Plus
X 23542271 X 22246721..22246841 133..250 195 79.3 Plus
X 23542271 X 22251703..22251823 133..250 195 79.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:39:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 9096937..9097405 387..855 2345 100 Plus
X 23527363 X 9096478..9096865 1..388 1940 100 Plus
X 23527363 X 9095251..9095638 1..388 1865 98.7 Plus
X 23527363 X 9095710..9096025 387..702 1535 99 Plus
X 23527363 X 9096001..9096169 687..855 815 98.8 Plus
X 23527363 X 9094070..9094231 31..192 390 82.7 Plus
X 23527363 X 9094546..9094724 414..592 355 79.8 Plus
X 23527363 X 9094874..9094953 787..866 205 83.7 Plus
X 23527363 X 9094306..9094418 276..388 190 77.8 Plus
X 23527363 X 13799108..13799184 107..31 190 83.1 Minus
X 23527363 X 22221664..22221764 6..107 185 80.3 Plus
X 23527363 X 22216669..22216769 6..107 185 80.3 Plus
X 23527363 X 22211672..22211772 6..107 185 80.3 Plus
X 23527363 X 22197427..22197527 6..107 185 80.3 Plus
X 23527363 X 22187282..22187382 6..107 185 80.3 Plus
X 23527363 X 22182273..22182373 6..107 185 80.3 Plus
X 23527363 X 22236681..22236781 6..107 185 80.3 Plus
X 23527363 X 22231699..22231799 6..107 185 80.3 Plus
X 23527363 X 22226671..22226771 6..107 185 80.3 Plus
X 23527363 X 22177372..22177472 6..107 185 80.3 Plus
X 23527363 X 22167592..22167692 6..107 185 80.3 Plus
X 23527363 X 22152754..22152854 6..107 185 80.3 Plus
X 23527363 X 22148022..22148122 6..107 185 80.3 Plus
X 23527363 X 22142986..22143086 6..107 185 80.3 Plus
X 23527363 X 22137941..22138041 6..107 185 80.3 Plus
X 23527363 X 22132888..22132988 6..107 185 80.3 Plus
X 23527363 X 22128157..22128257 6..107 185 80.3 Plus
X 23527363 X 22202502..22202578 31..107 175 81.8 Plus
X 23527363 X 22162604..22162704 6..107 170 79.4 Plus
X 23527363 X 22172469..22172569 6..107 155 78.4 Plus
X 23527363 X 22172643..22172703 190..250 140 81.9 Plus
X 23527363 X 22152928..22152988 190..250 140 81.9 Plus
X 23527363 X 22143160..22143220 190..250 140 81.9 Plus
X 23527363 X 22138115..22138175 190..250 140 81.9 Plus
X 23527363 X 22133062..22133122 190..250 140 81.9 Plus
X 23527363 X 22128331..22128391 190..250 140 81.9 Plus
X 23527363 X 22236855..22236915 190..250 140 81.9 Plus
X 23527363 X 22231873..22231933 190..250 140 81.9 Plus
X 23527363 X 22226845..22226905 190..250 140 81.9 Plus
X 23527363 X 22221838..22221898 190..250 140 81.9 Plus
X 23527363 X 22216843..22216903 190..250 140 81.9 Plus
X 23527363 X 22211846..22211906 190..250 140 81.9 Plus
X 23527363 X 22202652..22202712 190..250 140 81.9 Plus
X 23527363 X 22197601..22197661 190..250 140 81.9 Plus
X 23527363 X 22187456..22187516 190..250 140 81.9 Plus
X 23527363 X 22182447..22182507 190..250 140 81.9 Plus
X 23527363 X 22177546..22177606 190..250 140 81.9 Plus
Blast to na_te.dros performed on 2014-11-27 15:16:33 has no hits.

FI11086.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:26:44 Download gff for FI11086.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8980647..8981112 387..852 94   Plus
chrX 8980188..8980573 1..386 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-04 17:45:42 Download gff for FI11086.complete
Subject Subject Range Query Range Percent Splice Strand
CG6999-RA 1..702 92..793 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:18:02 Download gff for FI11086.complete
Subject Subject Range Query Range Percent Splice Strand
CG6999-RA 1..702 92..793 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:59:02 Download gff for FI11086.complete
Subject Subject Range Query Range Percent Splice Strand
CG6999-RA 1..702 92..793 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:26:44 Download gff for FI11086.complete
Subject Subject Range Query Range Percent Splice Strand
CG6999-RA 1..702 92..793 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-04 17:45:41 Download gff for FI11086.complete
Subject Subject Range Query Range Percent Splice Strand
CG6999-RA 14..865 1..852 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:18:02 Download gff for FI11086.complete
Subject Subject Range Query Range Percent Splice Strand
CG6999-RA 14..865 1..852 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:59:02 Download gff for FI11086.complete
Subject Subject Range Query Range Percent Splice Strand
CG6999-RA 14..865 1..852 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:26:44 Download gff for FI11086.complete
Subject Subject Range Query Range Percent Splice Strand
CG6999-RA 14..865 1..852 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:26:44 Download gff for FI11086.complete
Subject Subject Range Query Range Percent Splice Strand
X 9088839..9089304 387..852 100   Plus
X 9088380..9088765 1..386 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:59:02 Download gff for FI11086.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8982872..8983337 387..852 100   Plus
arm_X 8982413..8982798 1..386 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:07:21 Download gff for FI11086.complete
Subject Subject Range Query Range Percent Splice Strand
X 9096937..9097402 387..852 100   Plus
X 9096478..9096863 1..386 100 -> Plus

FI11086.hyp2 Sequence

Translation from 0 to 792

> FI11086.hyp2
TLQNIFDPAKTKATMKKIINTSKPKRKSTSMKVEETKLDEARWGKPQTKE
GESANGIANPSNDDKKELANFKATFNSWAPEKKREKMHKVGVILISNIPK
DMDGDCLKEIMNLHSVVGRVYVQPETLSSFKTKKNMRKGWVEFISKSGAK
KIALELNNKPITDGKSSRFRGLLWKMKFLPRFKWYYLTDRMDYELAVCKV
RVWSQARKRATFWYDPDQMEYFKKQVKKMKKMKKVKEAEMATRNAEMAAK
KAEMAAKKLKKSA*
Sequence FI11086.hyp2 has no blast hits.

FI11086.hyp Sequence

Translation from 1 to 792

> FI11086.hyp
TLQNIFDPAKTKATMKKIINTSKPKRKSTSMKVEETKLDEARWGKPQTKE
GESANGIANPSNDDKKELANFKATFNSWAPEKKREKMHKVGVILISNIPK
DMDGDCLKEIMNLHSVVGRVYVQPETLSSFKTKKNMRKGWVEFISKSGAK
KIALELNNKPITDGKSSRFRGLLWKMKFLPRFKWYYLTDRMDYELAVCKV
RVWSQARKRATFWYDPDQMEYFKKQVKKMKKMKKVKEAEMATRNAEMAAK
KAEMAAKKLKKSA*

FI11086.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG6999-PA 233 CG6999-PA 1..233 31..263 1222 100 Plus
CG32706-PA 230 CG32706-PA 1..230 31..263 1151 96.1 Plus
CG32708-PA 239 CG32708-PA 1..234 15..239 559 54.2 Plus
CG41562-PA 213 CG41562-PA 1..208 15..248 360 40.9 Plus
CG40813-PB 213 CG40813-PB 1..207 15..247 356 40.6 Plus

FI11086.pep Sequence

Translation from 43 to 792

> FI11086.pep
MKKIINTSKPKRKSTSMKVEETKLDEARWGKPQTKEGESANGIANPSNDD
KKELANFKATFNSWAPEKKREKMHKVGVILISNIPKDMDGDCLKEIMNLH
SVVGRVYVQPETLSSFKTKKNMRKGWVEFISKSGAKKIALELNNKPITDG
KSSRFRGLLWKMKFLPRFKWYYLTDRMDYELAVCKVRVWSQARKRATFWY
DPDQMEYFKKQVKKMKKMKKVKEAEMATRNAEMAAKKAEMAAKKLKKSA*

FI11086.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19191-PA 201 GF19191-PA 17..174 48..199 340 51.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:25:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18285-PA 216 GG18285-PA 1..184 17..199 390 48.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:25:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24320-PA 224 GH24320-PA 33..197 45..199 291 43 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:25:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG6999-PA 233 CG6999-PA 1..233 17..249 1222 100 Plus
CG32706-PA 230 CG32706-PA 1..230 17..249 1151 96.1 Plus
CG32708-PA 239 CG32708-PA 1..234 1..225 559 54.2 Plus
CG41562-PA 213 CG41562-PA 1..208 1..234 360 40.9 Plus
CG40813-PB 213 CG40813-PB 1..207 1..233 356 40.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14800-PA 233 GI14800-PA 52..205 53..199 306 47.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:25:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26836-PA 208 GL26836-PA 28..190 54..208 349 50.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17094-PA 208 GA17094-PA 28..190 54..208 354 50.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13716-PA 182 GM13716-PA 1..162 1..184 467 55.4 Plus
Dsec\GM18808-PA 182 GM18808-PA 1..162 1..184 467 55.4 Plus
Dsec\GM19664-PA 182 GM19664-PA 1..162 1..184 467 55.4 Plus
Dsec\GM13714-PA 145 GM13714-PA 11..142 27..153 289 53.7 Plus
Dsec\GM17585-PA 380 GM17585-PA 3..162 8..170 282 45.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16928-PA 353 GD16928-PA 174..353 16..216 485 56.7 Plus
Dsim\GD16928-PA 353 GD16928-PA 16..173 16..168 350 56.2 Plus
Dsim\GD15873-PA 347 GD15873-PA 193..332 28..170 275 45.1 Plus
Dsim\GD15873-PA 347 GD15873-PA 3..172 8..178 248 40.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19466-PA 218 GJ19466-PA 36..192 54..201 304 46 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25388-PA 233 GK25388-PA 51..217 54..208 313 46.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15817-PA 234 GE15817-PA 17..202 17..199 400 50.3 Plus