Clone FI11901 Report

Search the DGRC for FI11901

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:119
Well:1
Vector:pFlc-1
Associated Gene/TranscriptCG10353-RC
Protein status:FI11901.pep: gold
Sequenced Size:4217

Clone Sequence Records

FI11901.complete Sequence

4217 bp assembled on 2009-10-02

GenBank Submission: BT099944.1

> FI11901.complete
GTAATGCATCTGGCAACACTGGCCTCGGACGGTTCGCTTGTGGCGTTTAA
GTAAATTTATTAAAAACAAGCCTCGCTGGCGGTCTCCTTAATAATTGTTG
TCGGCAGTGCGAATCGAGTGGAGTGCGCGGGAGGCGGGATTGGAGGGGCA
GTGGGTATGTCAACTACAGTGAACACCAGCTAAAGTCAACGACAACAAAT
CCAGTCCGCACCAACGACTACGACTATCCCGAATCTGAAATGGACGAGCG
GGAGAGTCTGTACTTCGACACCATATCGCTGGCGGAATCGGAGGCGGCGG
CTGCTGCGGCGGCGCATCGCAAGTCGATCTCGCAGTCGCGCAACACCATC
TACCACTCGGCGGTCGATCTGGCGGGCGATGAGGGAGGCGGAGGAAGCGG
TGGAGGAAGGCTGCGTCTGGGCGGCGGAGCAGCCGCCGAGCACGCAGCGC
TTGCCTGGCAGCCTGGATACCGTCAGTCCACAGCACTGGAGCACCTCAAT
GGCGGCGGTGGTGGTGGTGGTGATCACACGGATGCCGCTATCGCCGCCCA
AATGATTGCCCTGCAAAACGGACGAAACCACCTGCCCACCGGGATCGGTG
TGACCGGAGATGGAGGACAAGGAGGTGGTGACGATGAGACATACAGACGC
TTCGACGATGGCAAACGGAGCGTGGACTTTGTGCTGGCTTACAACGGAGA
GACGCAGCTGGAGGAGCATCGGCGCAAATGCGAGATCTTTGAGGCGAATC
TGCAGCGAGAGGGCTTGCAGCTGGAGCACAACAAGGTGCAGCGCGTCCAT
TTCATCAAGATCCATGCGCCGGCGGAGGTGCTGTACCGCTATGCGGAAAT
ACTCAAGATTAAGGTGCCGCTCAAACCGATTCCCGGCCAGGATCAAATCT
TCGCCGAATCGGCGCACGAGTTCAAGACCTGCTTCAGTCGCATGTGCAAA
AGTCTCTTCAGCTCCGTCCAATTGAATACGGCCCTGTTTCCGGAACGCGA
ACCGCGCATCCATCTGGAGTTCTCCCGCAACTACCTGGAACTGTACGATA
CGGAGCACCCGAACTTTCTCGACGCCAGCACCCGCTACTCCATCATCAAT
TTCATTCTCCAGCGCCAGCGTTTCGTGGAGGGCGAGGAGACGGCCGACAA
TCTGGGCATCGAGAAGCTCGTCCAGGATGGCGTATATACCTGCGCCTACA
CCTTGCATGATAAAGACGATCGCGATCGGCTGCTAAAGGAGTGGGCCAAC
ATATCCAAGTGGAAGAACCTGCAACCACTGGACCAAATTAAAGACTACTT
TGGAGCAAAGGTGGCACTCTACTTTGCCTGGCTGGGATTCTACACGCAAA
TGCTGATACCCATTAGCGTGTTCGGCGTGCTCTGTTTTCTGTACGGCTTC
ATCACGTGGAACAGCGATCCGATTAGCCGGGACATTTGCGACGACAATGG
AACGATCATGTGTCCACAGTGCGACCGCAGCTGCGACTATTGGCGACTGA
ACGAGACGTGTACCTCCTCCAAGTTCAACTATCTGATAGACAACAATATG
ACAGTGGTGTTTGCCTTTTCGATGGCCATTTGGGCAGTGGTTTACCTGGA
GTTCTGGAAACGCTACTCGGCGGGCCTGGTGCACCGCTGGGGACTGACTG
GTTTTACCCACCACGTGGAGCACCCGCGTCCGCAATACTTGGCCAGAATA
TCGCGCACCAAGAAGCTGGCCGGAAAAGCATATGAGCAGGACCACACTGG
CAAGCGGACCATCTTGGATCCGGATGTGCCCTTCTGGAGTTTCAAGTTCC
TGCCAAACTTCACCAGCTATAGCATTATGGTCTTGTTTATTTGCATATCA
GTCATTGCCATAGCGGGCATAATCATCTATAGAATGGCACAGCGAGCATC
GCACAGCATTTTGGGCAGCGAGAATTCCATGACCTTTAAGGTTATGATAT
TGCCCATGACGGCGGGCATCATTGACCTTATAGTGATCTCGCTGCTGGAC
ATGGTCTACTCGAATTTGGCTGTAAAGCTAACCAACTACGAGTACTGTCG
CACCCAGACGGAATACGATGAGAGCCTAACTATCAAAAACTATGTGTTCC
AGTTCGTCAATTATTACTCCTCGCTCTTCTACATTGCCTTCCTCAAGGGC
AAGTTCGTCGGCTATCCGGCGAAGTACAATCGCGTGCTGGGCTTTCGCCA
GGAGGAGTGCAATCCTGGCGGCTGCCTTATGGAGCTCTGCATGCAGTTGG
TAATCATTATGGCTGGCAAGCAGGCGGTCAATGCCATCGTGGAGATGCTT
ATCCCCTATCTGATGCGCACCTTCAAGGAGCTGAGCTACCGCCACGGCTG
GTACAAGAGCCATCAGGACCAGCGTCTGGTGCCGTACAACCAGTTCACCG
AGGACTACAATCTACTGCCTGCCGAGAACAACTCGCTCTACGTGGAATAC
CTCGAAATGGTTGTGCAATTTGGCTTCATCACACTGTTTAGTCTGGCCTT
CCCATTGGCTCCGCTGCTGGCCCTGCTGAACAATGTGATTGAGGTGCGCC
TGGACGCCATCAAAATGCTGCGCTTCCTGCGACGGCCAGTGGGAATGCGA
GCGCGCGACATTGGCGTTTGGCACAGCATCATGACCGTCGTCACGCGGAT
TGCCGTGGCCTCGAGTGCAATGATAATCGCATTTAGCACGAACCTCATAC
CAAAAATCGTGTATGCCGCCTCCATGGGTGATCCCGAGCTGAACAACTAT
CTGAACTTCACGCTGGCCGTGTTCAACACCAAGGACTTTCAGGTGCAGCC
ACTGCTCGGTGGCAGTCAGCATGTGAACGAGACGGTGTGTCGCTACACTG
AGTTCCGAAACTCGCCGGAAGATCCGCATCCCTATAAACGTCCCATGATA
TATTGGAAGATACTGACGGGTCGGCTGGCCTTCATCGTCATCTACCAGAA
CATTATCACCATGCTGCAGGGCATCCTGCGCTGGGCCGTACCGGATGTCT
CGGGTCGCCTGCTGAAGCGCATCAAGCGGGAGAACTTCCTGCTGCGGGAG
CACATTATCGAGTACGAGAAACAGCACGCCATGAAACTGGTGCAGACGGA
ACTCAATGGCCAACAGAAGTCGGAAGGTGAACTGCGTCAGCGGAACAACG
AAACGGTGATCCGGAATCGCGACGAAGCCACCTCGTTCGTGTAGGAAGCG
GCGAATGGAAGCTGCATGTTCGTCAGATCATTCCTTGGTTTCCGCCCACC
CACAGAAACACGTAGTTAGCTAGACATTTGTATATACCGACACGCGAATA
TCTAGGGATTGTCGATCTAGGGATCGCATGGATGCAGTGCTTCGTACTTA
CGATGATTTTTGTACTGTGTTTGCATTGGAAATGCTCAACGAATATGGGG
GCATCGGAGCCTCGAGTCAAGCAATTGCATTTTTATATACATACACGAAT
AGGATTTTATATTGTTACTTGATTTCTCAAACGGATCGTTGTATTTTGTA
CAATGAGTATCCCGAATCATCACCCGATTGGATCAACAGTAAGGCCAAGT
CGCTTTAGCAGCACACAGAGATATACTACAATTCTAGGTATATGTATTTG
AATATTTTTAAATTATATACACCACCAAACTACACTACACTAGCACACCA
CATGTCCAAAGTGCATTAACGAGGAGTATTTATGATTTCAAAAAAAAGGG
ACAACTCCTGTTGGCCATGTTGGATCGATCATGAGCAAAACGATCACGAA
TTATATACACCACAAGTGGGTGCGAGCTTAAATGAGCTGGTAGCCCATCC
ATTCAGACACTAAGAAACAATCCAATGTACCTTGCAATGTTGCCCACAAA
CCGAGAAGCGAACTCAGACATATGTATGTGCGTTTCATCCTACTCCCAAC
ACCCCAAAAATCCATCGTTTTTATTGTTGATTATTGGCCAAGCGAGAAGC
GAGAGCATTGCACATTTCGCAATATTTTGTAGAACTCTAAATGCTACTTA
CCAGTGCGTAACACCTATAGTGAATTGTTGTTTTGATAAACATATTTATA
CGATACGAACTAAAACTAATCATAACAGCTACGATTACGATAGCGATTAA
GCCAGAAACAAAACAAATTGTGTTGTGTGCCGGATAAAAAAAAAAAATAT
GAGAAATAACAAATAAATCAAATGGACTTAACTCCATTAATGTGAACGGC
GAAAAAAAAAAAAAAAA

FI11901.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG10353-RC 4211 CG10353-RC 3..4201 1..4199 20980 99.9 Plus
CG10353-RD 4773 CG10353-RD 1209..4770 638..4199 17795 99.9 Plus
CG10353.b 4296 CG10353.b 725..4286 638..4199 17795 99.9 Plus
CG10353.b 4296 CG10353.b 1..638 1..638 3190 100 Plus
CG10353-RD 4773 CG10353-RD 688..1122 204..638 2175 100 Plus
CG10353-RD 4773 CG10353-RD 1..205 1..205 1025 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11768868..11770118 4199..2946 6130 99.4 Minus
chrX 22417052 chrX 11770798..11771419 2460..1839 3110 100 Minus
chrX 22417052 chrX 11772457..11773031 1211..637 2860 99.8 Minus
chrX 22417052 chrX 11771483..11772053 1838..1268 2840 99.8 Minus
chrX 22417052 chrX 11774317..11774753 638..202 2185 100 Minus
chrX 22417052 chrX 11770177..11770458 2948..2667 1395 99.6 Minus
chrX 22417052 chrX 11770524..11770731 2667..2460 1025 99.5 Minus
chrX 22417052 chrX 11778088..11778291 204..1 1005 99.5 Minus
chrX 22417052 chrX 11772337..11772392 1267..1212 280 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:29:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG10353-RK 3003 CG10353-PK 13..3003 204..3194 14940 100 Plus
CG10353-RI 2955 CG10353-PI 1..2955 240..3194 14760 100 Plus
CG10353-RC 2955 CG10353-PC 1..2955 240..3194 14760 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:23:11 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG10353-RC 4203 CG10353-RC 4..4202 1..4199 20980 100 Plus
CG10353-RK 4482 CG10353-RK 486..4481 204..4199 19965 100 Plus
CG10353-RI 4771 CG10353-RI 775..4770 204..4199 19965 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG10353-PK 1000 CG10353-PK 5..1000 204..3191 4637 100 Plus
CG10353-PE 1029 CG10353-PE 5..1029 204..3191 4597 97.1 Plus
CG10353-PF 1029 CG10353-PF 5..1029 204..3191 4597 97.1 Plus
CG10353-PD 1029 CG10353-PD 5..1029 204..3191 4597 97.1 Plus
CG10353-PI 984 CG10353-PI 1..984 240..3191 4570 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11877738..11878991 4199..2946 6270 100 Minus
X 23542271 X 11879671..11880292 2460..1839 3110 100 Minus
X 23542271 X 11881330..11881904 1211..637 2860 99.8 Minus
X 23542271 X 11880356..11880926 1838..1268 2855 100 Minus
X 23542271 X 11883188..11883624 638..202 2185 100 Minus
X 23542271 X 11879050..11879331 2948..2667 1410 100 Minus
X 23542271 X 11879397..11879604 2667..2460 1040 100 Minus
X 23542271 X 11886956..11887159 204..1 1020 100 Minus
X 23542271 X 11881210..11881265 1267..1212 280 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11885836..11887089 4199..2946 6270 100 Minus
X 23527363 X 11887769..11888390 2460..1839 3110 100 Minus
X 23527363 X 11889428..11890002 1211..637 2860 99.8 Minus
X 23527363 X 11888454..11889024 1838..1268 2855 100 Minus
X 23527363 X 11891286..11891722 638..202 2185 100 Minus
X 23527363 X 11887148..11887429 2948..2667 1410 100 Minus
X 23527363 X 11887495..11887702 2667..2460 1040 100 Minus
X 23527363 X 11895054..11895257 204..1 1020 100 Minus
X 23527363 X 11889308..11889363 1267..1212 280 100 Minus
Blast to na_te.dros performed on 2014-11-27 02:29:04 has no hits.

FI11901.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:18:28 Download gff for FI11901.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11778088..11778291 1..204 99   Minus
chrX 11774317..11774750 205..638 100 <- Minus
chrX 11772457..11773029 639..1211 99 <- Minus
chrX 11772337..11772392 1212..1267 100 <- Minus
chrX 11771483..11772053 1268..1838 99 <- Minus
chrX 11770798..11771419 1839..2460 100 <- Minus
chrX 11770525..11770730 2461..2666 99 <- Minus
chrX 11770177..11770458 2667..2948 99 <- Minus
chrX 11768866..11770115 2949..4201 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:40 Download gff for FI11901.complete
Subject Subject Range Query Range Percent Splice Strand
CG10353-RC 1..2955 240..3194 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:37:09 Download gff for FI11901.complete
Subject Subject Range Query Range Percent Splice Strand
CG10353-RC 1..2955 240..3194 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:38:22 Download gff for FI11901.complete
Subject Subject Range Query Range Percent Splice Strand
CG10353-RC 1..2955 240..3194 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:18:28 Download gff for FI11901.complete
Subject Subject Range Query Range Percent Splice Strand
CG10353-RK 13..3003 204..3194 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-02 11:01:37 Download gff for FI11901.complete
Subject Subject Range Query Range Percent Splice Strand
CG10353-RC 1..4198 1..4198 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:37:09 Download gff for FI11901.complete
Subject Subject Range Query Range Percent Splice Strand
CG10353-RC 1..4198 1..4198 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:38:22 Download gff for FI11901.complete
Subject Subject Range Query Range Percent Splice Strand
CG10353-RC 4..4203 1..4200 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:18:28 Download gff for FI11901.complete
Subject Subject Range Query Range Percent Splice Strand
CG10353-RC 4..4203 1..4200 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:18:28 Download gff for FI11901.complete
Subject Subject Range Query Range Percent Splice Strand
X 11886956..11887159 1..204 100   Minus
X 11883188..11883621 205..638 100 <- Minus
X 11881330..11881902 639..1211 99 <- Minus
X 11881210..11881265 1212..1267 100 <- Minus
X 11880356..11880926 1268..1838 100 <- Minus
X 11879671..11880292 1839..2460 100 <- Minus
X 11879398..11879603 2461..2666 100 <- Minus
X 11879050..11879331 2667..2948 100 <- Minus
X 11877736..11878988 2949..4201 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:38:22 Download gff for FI11901.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11780989..11781192 1..204 100   Minus
arm_X 11777221..11777654 205..638 100 <- Minus
arm_X 11775363..11775935 639..1211 99 <- Minus
arm_X 11775243..11775298 1212..1267 100 <- Minus
arm_X 11774389..11774959 1268..1838 100 <- Minus
arm_X 11773704..11774325 1839..2460 100 <- Minus
arm_X 11773431..11773636 2461..2666 100 <- Minus
arm_X 11773083..11773364 2667..2948 100 <- Minus
arm_X 11771769..11773021 2949..4201 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:20:12 Download gff for FI11901.complete
Subject Subject Range Query Range Percent Splice Strand
X 11895054..11895257 1..204 100   Minus
X 11891286..11891719 205..638 100 <- Minus
X 11889428..11890000 639..1211 99 <- Minus
X 11889308..11889363 1212..1267 100 <- Minus
X 11888454..11889024 1268..1838 100 <- Minus
X 11887769..11888390 1839..2460 100 <- Minus
X 11887496..11887701 2461..2666 100 <- Minus
X 11887148..11887429 2667..2948 100 <- Minus
X 11885834..11887086 2949..4201 99 <- Minus

FI11901.pep Sequence

Translation from 239 to 3193

> FI11901.pep
MDERESLYFDTISLAESEAAAAAAAHRKSISQSRNTIYHSAVDLAGDEGG
GGSGGGRLRLGGGAAAEHAALAWQPGYRQSTALEHLNGGGGGGGDHTDAA
IAAQMIALQNGRNHLPTGIGVTGDGGQGGGDDETYRRFDDGKRSVDFVLA
YNGETQLEEHRRKCEIFEANLQREGLQLEHNKVQRVHFIKIHAPAEVLYR
YAEILKIKVPLKPIPGQDQIFAESAHEFKTCFSRMCKSLFSSVQLNTALF
PEREPRIHLEFSRNYLELYDTEHPNFLDASTRYSIINFILQRQRFVEGEE
TADNLGIEKLVQDGVYTCAYTLHDKDDRDRLLKEWANISKWKNLQPLDQI
KDYFGAKVALYFAWLGFYTQMLIPISVFGVLCFLYGFITWNSDPISRDIC
DDNGTIMCPQCDRSCDYWRLNETCTSSKFNYLIDNNMTVVFAFSMAIWAV
VYLEFWKRYSAGLVHRWGLTGFTHHVEHPRPQYLARISRTKKLAGKAYEQ
DHTGKRTILDPDVPFWSFKFLPNFTSYSIMVLFICISVIAIAGIIIYRMA
QRASHSILGSENSMTFKVMILPMTAGIIDLIVISLLDMVYSNLAVKLTNY
EYCRTQTEYDESLTIKNYVFQFVNYYSSLFYIAFLKGKFVGYPAKYNRVL
GFRQEECNPGGCLMELCMQLVIIMAGKQAVNAIVEMLIPYLMRTFKELSY
RHGWYKSHQDQRLVPYNQFTEDYNLLPAENNSLYVEYLEMVVQFGFITLF
SLAFPLAPLLALLNNVIEVRLDAIKMLRFLRRPVGMRARDIGVWHSIMTV
VTRIAVASSAMIIAFSTNLIPKIVYAASMGDPELNNYLNFTLAVFNTKDF
QVQPLLGGSQHVNETVCRYTEFRNSPEDPHPYKRPMIYWKILTGRLAFIV
IYQNIITMLQGILRWAVPDVSGRLLKRIKRENFLLREHIIEYEKQHAMKL
VQTELNGQQKSEGELRQRNNETVIRNRDEATSFV*

FI11901.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21590-PA 1045 GF21590-PA 200..1045 132..984 4136 90.4 Plus
Dana\GF18455-PA 1080 GF18455-PA 114..1014 82..947 1720 39.3 Plus
Dana\GF25308-PA 1228 GF25308-PA 340..1154 138..937 1217 34.5 Plus
Dana\GF14339-PA 1335 GF14339-PA 154..734 176..829 439 26 Plus
Dana\GF21590-PA 1045 GF21590-PA 17..121 1..117 425 77.8 Plus
Dana\GF21728-PA 646 GF21728-PA 163..576 306..819 364 26.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18823-PA 1052 GG18823-PA 17..1052 1..984 4733 90.7 Plus
Dere\GG15908-PA 1075 GG15908-PA 95..999 54..947 1740 39.4 Plus
Dere\GG15549-PA 1219 GG15549-PA 331..1156 138..952 1237 34.8 Plus
Dere\GG25146-PA 1347 GG25146-PA 141..721 176..829 455 26.3 Plus
Dere\GG18235-PA 646 GG18235-PA 163..576 306..819 354 25.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12469-PA 1023 GH12469-PA 28..1023 1..984 3763 72.2 Plus
Dgri\GH22385-PA 1070 GH22385-PA 196..1007 138..947 1674 41.7 Plus
Dgri\GH17132-PA 1232 GH17132-PA 317..1169 120..952 1226 34.2 Plus
Dgri\GH10918-PA 1791 GH10918-PA 577..1135 195..816 426 27.3 Plus
Dgri\GH11928-PA 630 GH11928-PA 161..564 307..810 343 24.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG10353-PK 1000 CG10353-PK 17..1000 1..984 5174 100 Plus
CG10353-PI 984 CG10353-PI 1..984 1..984 5174 100 Plus
CG10353-PC 984 CG10353-PC 1..984 1..984 5174 100 Plus
CG10353-PE 1029 CG10353-PE 17..1029 1..984 5134 97.1 Plus
CG10353-PL 1013 CG10353-PL 1..1013 1..984 5134 97.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11145-PA 1237 GI11145-PA 17..1003 1..984 3651 71 Plus
Dmoj\GI11146-PA 987 GI11146-PA 1..942 1..944 3585 72.5 Plus
Dmoj\GI24621-PA 1068 GI24621-PA 190..1002 138..947 1689 41.7 Plus
Dmoj\GI11741-PA 1243 GI11741-PA 329..1180 120..952 1265 34.8 Plus
Dmoj\GI13291-PA 1344 GI13291-PA 153..740 176..829 432 26.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20401-PA 800 GL20401-PA 17..797 1..738 3336 82.3 Plus
Dper\GL11957-PA 996 GL11957-PA 81..930 11..947 1600 37.3 Plus
Dper\GL25113-PA 1203 GL25113-PA 315..1140 138..952 1212 34.2 Plus
Dper\GL20403-PA 166 GL20403-PA 1..166 776..984 592 59.9 Plus
Dper\GL26028-PA 1355 GL26028-PA 149..730 176..829 443 26.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10267-PA 988 GA10267-PA 17..988 1..984 4477 87.5 Plus
Dpse\GA14102-PA 1063 GA14102-PA 81..997 11..947 1741 38.5 Plus
Dpse\GA14102-PB 912 GA14102-PB 34..846 138..947 1735 41.7 Plus
Dpse\GA19969-PA 1236 GA19969-PA 348..1173 138..952 1212 34.2 Plus
Dpse\GA13617-PA 1355 GA13617-PA 149..730 176..829 449 26.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26900-PA 1055 GM26900-PA 95..979 54..947 1615 37.6 Plus
Dsec\GM13589-PA 351 GM13589-PA 17..342 1..328 1458 97.6 Plus
Dsec\GM15927-PA 1350 GM15927-PA 144..730 176..829 453 26.4 Plus
Dsec\GM13377-PA 646 GM13377-PA 163..576 306..819 349 25.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15959-PA 545 GD15959-PA 109..545 548..984 2251 99.3 Plus
Dsim\GD20108-PA 1075 GD20108-PA 95..999 54..947 1746 39.3 Plus
Dsim\GD14349-PA 1219 GD14349-PA 323..1145 130..937 1223 34.7 Plus
Dsim\GD15959-PA 545 GD15959-PA 1..110 235..344 595 98.2 Plus
Dsim\GD23993-PA 1349 GD23993-PA 144..714 176..816 452 26.3 Plus
Dsim\GD15957-PA 157 GD15957-PA 1..120 1..122 422 96.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18522-PA 1018 GJ18522-PA 17..1018 1..984 3827 74.1 Plus
Dvir\GJ24534-PA 1063 GJ24534-PA 78..997 46..947 1724 39.6 Plus
Dvir\GJ11413-PA 1235 GJ11413-PA 321..1172 120..952 1251 34.7 Plus
Dvir\GJ19453-PA 642 GJ19453-PA 160..573 306..819 324 24.1 Plus
Dvir\GJ11911-PA 390 GJ11911-PA 35..389 439..796 297 29.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25421-PA 1018 GK25421-PA 16..1018 1..984 3961 76.9 Plus
Dwil\GK12071-PA 1060 GK12071-PA 100..993 67..947 1742 39.7 Plus
Dwil\GK16934-PA 1259 GK16934-PA 371..1196 138..952 1226 34.3 Plus
Dwil\GK18314-PA 1365 GK18314-PA 158..735 176..829 450 27.8 Plus
Dwil\GK19948-PA 651 GK19948-PA 168..581 306..819 336 25 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:25:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17587-PA 1052 GE17587-PA 17..1052 1..984 4822 91.3 Plus
Dyak\GE25120-PA 1075 GE25120-PA 116..999 75..947 1743 39.9 Plus
Dyak\GE21872-PA 1229 GE21872-PA 341..1166 138..952 1233 34.9 Plus
Dyak\GE20847-PA 1343 GE20847-PA 138..718 176..829 445 26.1 Plus
Dyak\GE15653-PA 646 GE15653-PA 163..576 306..819 333 24.2 Plus

FI11901.hyp Sequence

Translation from 239 to 3193

> FI11901.hyp
MDERESLYFDTISLAESEAAAAAAAHRKSISQSRNTIYHSAVDLAGDEGG
GGSGGGRLRLGGGAAAEHAALAWQPGYRQSTALEHLNGGGGGGGDHTDAA
IAAQMIALQNGRNHLPTGIGVTGDGGQGGGDDETYRRFDDGKRSVDFVLA
YNGETQLEEHRRKCEIFEANLQREGLQLEHNKVQRVHFIKIHAPAEVLYR
YAEILKIKVPLKPIPGQDQIFAESAHEFKTCFSRMCKSLFSSVQLNTALF
PEREPRIHLEFSRNYLELYDTEHPNFLDASTRYSIINFILQRQRFVEGEE
TADNLGIEKLVQDGVYTCAYTLHDKDDRDRLLKEWANISKWKNLQPLDQI
KDYFGAKVALYFAWLGFYTQMLIPISVFGVLCFLYGFITWNSDPISRDIC
DDNGTIMCPQCDRSCDYWRLNETCTSSKFNYLIDNNMTVVFAFSMAIWAV
VYLEFWKRYSAGLVHRWGLTGFTHHVEHPRPQYLARISRTKKLAGKAYEQ
DHTGKRTILDPDVPFWSFKFLPNFTSYSIMVLFICISVIAIAGIIIYRMA
QRASHSILGSENSMTFKVMILPMTAGIIDLIVISLLDMVYSNLAVKLTNY
EYCRTQTEYDESLTIKNYVFQFVNYYSSLFYIAFLKGKFVGYPAKYNRVL
GFRQEECNPGGCLMELCMQLVIIMAGKQAVNAIVEMLIPYLMRTFKELSY
RHGWYKSHQDQRLVPYNQFTEDYNLLPAENNSLYVEYLEMVVQFGFITLF
SLAFPLAPLLALLNNVIEVRLDAIKMLRFLRRPVGMRARDIGVWHSIMTV
VTRIAVASSAMIIAFSTNLIPKIVYAASMGDPELNNYLNFTLAVFNTKDF
QVQPLLGGSQHVNETVCRYTEFRNSPEDPHPYKRPMIYWKILTGRLAFIV
IYQNIITMLQGILRWAVPDVSGRLLKRIKRENFLLREHIIEYEKQHAMKL
VQTELNGQQKSEGELRQRNNETVIRNRDEATSFV*

FI11901.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG10353-PK 1000 CG10353-PK 17..1000 1..984 5174 100 Plus
CG10353-PI 984 CG10353-PI 1..984 1..984 5174 100 Plus
CG10353-PC 984 CG10353-PC 1..984 1..984 5174 100 Plus
CG10353-PE 1029 CG10353-PE 17..1029 1..984 5134 97.1 Plus
CG10353-PL 1013 CG10353-PL 1..1013 1..984 5134 97.1 Plus