Clone FI11925 Report

Search the DGRC for FI11925

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:119
Well:25
Vector:pFlc-1
Associated Gene/TranscriptLpR1-RD
Protein status:FI11925.pep: gold
Sequenced Size:3384

Clone Sequence Records

FI11925.complete Sequence

3384 bp assembled on 2009-10-02

GenBank Submission: BT099946.1

> FI11925.complete
ACTCAGTTGGCGGCGAACCTCTCAACCAAACGGATGTAAACGCGCAAAAG
TGTGAAAGGACTGCCTCCTTAGCTGAAAGGGGAATTTGCATATAAATATA
TATATATATACTATATATAAACATAAAAAATACGGGGAAGCCCGAAAACT
CAAAGAAACGTGTGAAAAGCCAGGCAGCGAAAGTGTGCCAAGTGTCTCCT
CAAGGAAAGCACATTGTGAAAGTCGCGGGAAAAAACTACGGAAAATGGGG
CGCATTTGGTGTTTACTCTTCGTTAGCAGTTTGCTGCACACTCAGAGCCA
AAGTTTTCGCGTTCTGGCTATAAATGAGGCCACTTGCTCGTCGGACCAAT
TCCGTTGCGGGAATGGCAACTGCATACCGAACAAATGGCGCTGCGATCAG
GAGAGCGATTGTGCCGATGGCTCCGATGAAGCCAACGAATTGTGCAGAGC
TCGAACCTGTTCACCGGATGAATATGCCTGCAAGAGTGGCGAGGGGCAAT
GTGTTCCTTTGGCCTGGATGTGCGACCAGAGCAAGGACTGCAGCGATGGC
TCCGACGAGCACAACTGCAACCAGACCTGTCGTGCCGACGAGTTCACCTG
CGGCAATGGACGGTGCATCCAGAAGCGATGGAAGTGCGACCACGACGACG
ACTGCGGCGATGGATCCGACGAGAAGGAGTGCCCAGTGGTGCCCTGCGAC
TCCGTGGCGGAGCACACCTGCACGAATGGAGCCTGCATCGCCAAGCGGTG
GGTCTGCGACGGTGATCCGGACTGCTCCGATGGCTCCGATGAGCGGTCCT
GTGCGAATGTGACCAAGACGACCACGCCCTGCTTATCGCACGAATACCAG
TGCAAGGATCGCATCACCTGCCTGCATCACAGCTGGCTCTGCGATGGTGA
CCGCGACTGTCCCGATGGCGACGATGAGCACACAGCCAACTGCAAGAACG
TCACCTGCCGGGCGGACCAGTTCCAGTGCGGCGATCGCAGCTGCATTCCA
GGACATCTCACCTGCAACGGCGACAAGGACTGCGCCGATGGCAGCGACGA
ACGGGATTGCGGATTGAGTCTGAGTCTGGGGATCAACCAAGGAGGATGCA
ACGCAACCAGCGAATTCGACTGCGGTGGAGGTCAGTGCGTTCCACTCTCG
AAGGTCTGCGACAAGAGGAAGGATTGTCCGGATGGCGAGGACGAGCCGGC
AGGAAAGTGCGGGATAAACGAGTGCGCCTCGAAGAACGGAGGCTGCATGC
ACCAGTGCATCGATCTGAAGGTGGGCCACCACTGCGAATGCCACGAGGGT
TACAAGTTGTCTCCGGACAAGCGGAACTGCCAGGATATCAATGAGTGCGA
AGTTCCCGGAAAGTGCTCTCAGATATGCGTGAACGAAATAGGAGGCTTCA
AGTGTGAGTGCGAAGCGGGCTACATGAGGGATCCCAAAAATCACACCAGA
TGCAAGGCCAGCGAGGGACACGCCTCCCTGCTCCTGGCCAGACGCCATGA
CATCCGCAAGATAGCACTCGACCACATGGAAATGACCTCCATTGTGAATA
GTACAAAGGCAGCCACTGCCCTGGACTTTGTGTTCCGCACGGGTATGATC
TTCTGGAGCGATGTGACCACCCAGAGTATATATAAAGCACCGATTGATGA
GGGAAACGAAAAGACGGTAGTGTTGACTAAATCCTCGGTGACCTCGGATG
GCCTGGCTGTCGATTGGATCTATAACCATGTCTACTTTACGGACACCCAC
AAGTGCACCATCGAACTGACCAACTTCGAGGGCAGCATGGGTAAGGTCCT
GGTAAAGGACTCCCTGGACATTCCTCGTTCAATTGCTTTGGATCCCATTG
AGGGCTGGATGTACTGGTCCGACTGGGGCGCCTCTCCGCGCATCGAAAGG
GCGGGTATGGATGGCTCCCACCGCACCACCATCATCAGCTATGACGTCAA
GTGGCCCAATGGTATCACCTTAGACCTGGTTAAGAAACGCATCTACTGGG
TAGATGGCAAGCTTAACGTTATCTCGTCGGCGAACTATGATGGCTCGCAA
AGGAGCCAGGTGCTCTACTCCGGCGAATACCTGCGACATCCCTTCTCGAT
CACCACCTTCGAGGACAATGTCTACTGGACCGACTGGGACAAACAGGCCG
TCTTCAAGGCGAACAAGTTCACCGGGGAGGATGTGGAGCCCGTTACAGCA
ATGCATATGCTCCAGCATCCAATGGTGGTGCACGTGTACCATCCTTACCG
CCAGCCGGATGGCGTGAATCACTGCCAGTCGGTGAATGGCCACTGTTCTC
ATCTCTGCCTGCCAGCTCCCAGGATCAATGAGAGGAGTCCTCGCATATCC
TGCGCCTGTCCCACCGGTCTGAAGCTGATGGTCGATGGCCTCATGTGCGT
CGAGGATCTTGCCGACCAGCGTCCAGTGAAAAACCATACTCAAATCGAAA
AGACCACAACGCCCAGTGAGCAGCCGGATTCCGGCTTTATTGCACTGGTG
GTCATAGCCAGTCTTAGTGGATTCGCTGTCCTGCTATCGGTGCTCCTGCT
CATTGGCTACCGCTACTGCAGCAAGCGACGCATCAACTCGATGAACTTCG
AGAACCCCATCTACCGCAAGACCACCACCACAGAGGATCACTTCAGTTTG
CGCAAAAATCTGCCGGCGCGGATCTACGACCACACCAGTGTCATGGATGA
GGAGTACTCACCCGTCATAGGCATATCCTCGTATTAGATTGATTCCTCTG
GAATCGTGTGAAATGTGGATTGGATGATTGTTGCGCTTGGTCGCTGGGAA
AATTAGATGACCAATGCTAACTCGAGACCCGCGGCAGAAACACACACGCC
TGAAGACTGAGCAACTCTGTGTATTGTGTAAATTAATTATTTTAAAATTT
TAAGGCACGGCAAGGACGGCGGGTCACCTTGGAGCGCATCCTTAAAGGAT
GCTGTACAAAATACTATGTCGCAGAGTTCTATCACAAATAAACAAAAGAA
AAACAAAACAGAAATAGTTACGAGAAACGTAAAAGGAAACGAGAAATCTA
ATTGCTAATTATAAATTACATAGTTCCAAACTGTATATAGCTGTAAGTGT
GCATTATTTTTAAATGACGCAACTTAATATTACTATACGTAAACATGACA
AAGAGATCATTGTGCTTATGGTCTACTATTAGAGCAAGTTGAGAAATTAT
ATTTCTGTTGTCAAGGAGCAGAGTCGTTTTATTATATTAAAATTATTACT
GCATACGTATTAGCCTTTTGTTAACTGTATTTGTTAAGTGTACATACATA
TGTATATGTTTCCCCACTAAAAAGAAAATATGATGAATAATAAACTCAGA
ACATACTTATGTGTAGCTAAAAAAAAAAAAAAAA

FI11925.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:52:55
Subject Length Description Subject Range Query Range Score Percent Strand
LpR1-RD 3371 LpR1-RD 1..3367 1..3367 16835 100 Plus
LpR1-RG 3546 LpR1-RG 1..2408 1..2408 12040 100 Plus
LpR1-RI 3663 LpR1-RI 560..2525 443..2408 9830 100 Plus
LpR1-RI 3663 LpR1-RI 2703..3661 2409..3367 4795 100 Plus
LpR1-RG 3546 LpR1-RG 2586..3544 2409..3367 4795 100 Plus
LpR1-RI 3663 LpR1-RI 1..446 1..446 2230 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21567974..21569387 2209..796 6965 99.5 Minus
chr3R 27901430 chr3R 21564344..21565008 3367..2703 3295 99.7 Minus
chr3R 27901430 chr3R 21529851..21530963 2209..1097 3045 84.9 Minus
chr3R 27901430 chr3R 21569997..21570223 796..570 1135 100 Minus
chr3R 27901430 chr3R 21567678..21567877 2408..2209 1000 100 Minus
chr3R 27901430 chr3R 21575786..21575980 195..1 975 100 Minus
chr3R 27901430 chr3R 21565148..21565310 2704..2542 815 100 Minus
chr3R 27901430 chr3R 21529322..21529514 2408..2216 695 90.7 Minus
chr3R 27901430 chr3R 21565386..21565519 2542..2409 670 100 Minus
chr3R 27901430 chr3R 21575046..21575176 326..196 655 100 Minus
chr3R 27901430 chr3R 21571093..21571215 569..447 615 100 Minus
chr3R 27901430 chr3R 21572259..21572380 447..326 610 100 Minus
chr3R 27901430 chr3R 21532449..21532551 676..574 275 84.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
LpR1-RD 2493 CG31094-PD 1..2493 245..2737 12465 100 Plus
LpR1-RL 2937 CG31094-PL 526..2937 326..2737 12060 100 Plus
LpR1-RR 2607 CG31094-PR 434..2607 564..2737 10870 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:23:15 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
LpR1-RD 3369 CG31094-RD 1..3367 1..3367 16835 100 Plus
LpR1-RL 3798 CG31094-RL 755..3796 326..3367 15210 100 Plus
LpR1-RR 3286 CG31094-RR 481..3284 564..3367 14020 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
LpR1-PD 830 CG31094-PD 1..824 245..2716 4350 100 Plus
LpR1-PL 978 CG31094-PL 176..972 326..2716 4212 100 Plus
LpR1-PG 889 CG31094-PG 1..883 245..2716 4123 90.9 Plus
LpR1-PR 868 CG31094-PR 68..862 326..2716 4062 97 Plus
LpR1-PQ 976 CG31094-PQ 176..970 326..2716 4062 97 Plus
LpR1-PL 978 CG31094-PL 136..256 956..1330 185 33.1 Plus
LpR1-PR 868 CG31094-PR 19..150 929..1378 185 30.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25744980..25746393 2209..796 7070 100 Minus
3R 32079331 3R 25741350..25742014 3367..2703 3325 100 Minus
3R 32079331 3R 25706816..25707928 2209..1097 3015 84.7 Minus
3R 32079331 3R 25747007..25747233 796..570 1135 100 Minus
3R 32079331 3R 25744684..25744883 2408..2209 1000 100 Minus
3R 32079331 3R 25752801..25752995 195..1 975 100 Minus
3R 32079331 3R 25742154..25742316 2704..2542 815 100 Minus
3R 32079331 3R 25706287..25706479 2408..2216 680 90.2 Minus
3R 32079331 3R 25742392..25742525 2542..2409 670 100 Minus
3R 32079331 3R 25752061..25752191 326..196 655 100 Minus
3R 32079331 3R 25748103..25748225 569..447 615 100 Minus
3R 32079331 3R 25749269..25749390 447..326 610 100 Minus
3R 32079331 3R 25709411..25709513 676..574 260 83.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25485811..25487224 2209..796 7070 100 Minus
3R 31820162 3R 25482181..25482845 3367..2703 3325 100 Minus
3R 31820162 3R 25447647..25448492 2209..1364 2730 88.1 Minus
3R 31820162 3R 25487838..25488064 796..570 1135 100 Minus
3R 31820162 3R 25485515..25485714 2408..2209 1000 100 Minus
3R 31820162 3R 25493632..25493826 195..1 975 100 Minus
3R 31820162 3R 25482985..25483147 2704..2542 815 100 Minus
3R 31820162 3R 25447118..25447310 2408..2216 680 90.1 Minus
3R 31820162 3R 25483223..25483356 2542..2409 670 100 Minus
3R 31820162 3R 25492892..25493022 326..196 655 100 Minus
3R 31820162 3R 25488934..25489056 569..447 615 100 Minus
3R 31820162 3R 25490100..25490221 447..326 610 100 Minus
3R 31820162 3R 25448560..25448705 1296..1151 370 83.5 Minus
3R 31820162 3R 25450242..25450344 676..574 260 83.4 Minus
3R 31820162 3R 25442207..25442247 2625..2585 160 92.6 Minus
3R 31820162 3R 25448793..25448881 1051..963 160 78.6 Minus
3R 31820162 3R 25450876..25450967 549..458 145 77.1 Minus
Blast to na_te.dros performed 2014-11-26 21:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 920..1203 2990..3273 148 54 Plus
Dbuz\INE-1 1467 Dbuz\INE-1 ISBU1 1467bp 457..510 3280..3334 119 70.9 Plus

FI11925.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:39:57 Download gff for FI11925.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21575046..21575176 196..326 100 <- Minus
chr3R 21572260..21572379 327..446 100 <- Minus
chr3R 21571093..21571215 447..569 100 <- Minus
chr3R 21569997..21570223 570..796 100 <- Minus
chr3R 21567974..21569386 797..2209 99 <- Minus
chr3R 21567678..21567876 2210..2408 100 <- Minus
chr3R 21565386..21565519 2409..2542 100 <- Minus
chr3R 21565148..21565309 2543..2704 100 <- Minus
chr3R 21564342..21565006 2705..3368 92 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:14:15 Download gff for FI11925.complete
Subject Subject Range Query Range Percent Splice Strand
LpR1-RD 1..2493 245..2737 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:40:26 Download gff for FI11925.complete
Subject Subject Range Query Range Percent Splice Strand
LpR1-RD 1..2493 245..2737 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:33:46 Download gff for FI11925.complete
Subject Subject Range Query Range Percent Splice Strand
LpR1-RD 1..2493 245..2737 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:39:57 Download gff for FI11925.complete
Subject Subject Range Query Range Percent Splice Strand
LpR1-RD 1..2493 245..2737 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:14:12 Download gff for FI11925.complete
Subject Subject Range Query Range Percent Splice Strand
LpR1-RD 1..3367 1..3368 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:40:26 Download gff for FI11925.complete
Subject Subject Range Query Range Percent Splice Strand
LpR1-RD 1..3367 1..3368 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:33:46 Download gff for FI11925.complete
Subject Subject Range Query Range Percent Splice Strand
LpR1-RD 1..3367 1..3368 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:39:57 Download gff for FI11925.complete
Subject Subject Range Query Range Percent Splice Strand
LpR1-RD 1..3367 1..3368 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:39:57 Download gff for FI11925.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25752801..25752995 1..195 100   Minus
3R 25752061..25752191 196..326 100 <- Minus
3R 25749270..25749389 327..446 100 <- Minus
3R 25748103..25748225 447..569 100 <- Minus
3R 25747007..25747233 570..796 100 <- Minus
3R 25744980..25746392 797..2209 100 <- Minus
3R 25744684..25744882 2210..2408 100 <- Minus
3R 25742392..25742525 2409..2542 100 <- Minus
3R 25742154..25742315 2543..2704 100 <- Minus
3R 25741348..25742012 2705..3368 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:33:46 Download gff for FI11925.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21578523..21578717 1..195 100   Minus
arm_3R 21577783..21577913 196..326 100 <- Minus
arm_3R 21574992..21575111 327..446 100 <- Minus
arm_3R 21573825..21573947 447..569 100 <- Minus
arm_3R 21572729..21572955 570..796 100 <- Minus
arm_3R 21570702..21572114 797..2209 100 <- Minus
arm_3R 21570406..21570604 2210..2408 100 <- Minus
arm_3R 21568114..21568247 2409..2542 100 <- Minus
arm_3R 21567876..21568037 2543..2704 100 <- Minus
arm_3R 21567070..21567734 2705..3368 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:22:21 Download gff for FI11925.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25493632..25493826 1..195 100   Minus
3R 25492892..25493022 196..326 100 <- Minus
3R 25490101..25490220 327..446 100 <- Minus
3R 25488934..25489056 447..569 100 <- Minus
3R 25487838..25488064 570..796 100 <- Minus
3R 25485811..25487223 797..2209 100 <- Minus
3R 25485515..25485713 2210..2408 100 <- Minus
3R 25483223..25483356 2409..2542 100 <- Minus
3R 25482985..25483146 2543..2704 100 <- Minus
3R 25482179..25482843 2705..3368 99 <- Minus

FI11925.pep Sequence

Translation from 244 to 2736

> FI11925.pep
MGRIWCLLFVSSLLHTQSQSFRVLAINEATCSSDQFRCGNGNCIPNKWRC
DQESDCADGSDEANELCRARTCSPDEYACKSGEGQCVPLAWMCDQSKDCS
DGSDEHNCNQTCRADEFTCGNGRCIQKRWKCDHDDDCGDGSDEKECPVVP
CDSVAEHTCTNGACIAKRWVCDGDPDCSDGSDERSCANVTKTTTPCLSHE
YQCKDRITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQFQCGDRSC
IPGHLTCNGDKDCADGSDERDCGLSLSLGINQGGCNATSEFDCGGGQCVP
LSKVCDKRKDCPDGEDEPAGKCGINECASKNGGCMHQCIDLKVGHHCECH
EGYKLSPDKRNCQDINECEVPGKCSQICVNEIGGFKCECEAGYMRDPKNH
TRCKASEGHASLLLARRHDIRKIALDHMEMTSIVNSTKAATALDFVFRTG
MIFWSDVTTQSIYKAPIDEGNEKTVVLTKSSVTSDGLAVDWIYNHVYFTD
THKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWMYWSDWGASPRI
ERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDG
SQRSQVLYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPV
TAMHMLQHPMVVHVYHPYRQPDGVNHCQSVNGHCSHLCLPAPRINERSPR
ISCACPTGLKLMVDGLMCVEDLADQRPVKNHTQIEKTTTPSEQPDSGFIA
LVVIASLSGFAVLLSVLLLIGYRYCSKRRINSMNFENPIYRKTTTTEDHF
SLRKNLPARIYDHTSVMDEEYSPVIGISSY*

FI11925.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18234-PA 1036 GF18234-PA 179..1036 28..830 3945 87.2 Plus
Dana\GF18235-PA 1068 GF18235-PA 227..1050 26..822 2861 66.7 Plus
Dana\GF21799-PA 4648 GF21799-PA 1034..1784 36..760 1216 37.8 Plus
Dana\GF20503-PA 876 GF20503-PA 65..784 43..764 1143 37.5 Plus
Dana\GF21799-PA 4648 GF21799-PA 2745..3541 30..721 1088 33.3 Plus
Dana\GF12345-PA 4651 GF12345-PA 2675..3353 38..718 1033 35.9 Plus
Dana\GF21799-PA 4648 GF21799-PA 3669..4389 35..706 994 34.1 Plus
Dana\GF21799-PA 4648 GF21799-PA 31..680 72..718 797 30.7 Plus
Dana\GF21799-PA 4648 GF21799-PA 3540..3823 29..317 442 39.9 Plus
Dana\GF21799-PA 4648 GF21799-PA 636..1026 325..729 407 26.7 Plus
Dana\GF21799-PA 4648 GF21799-PA 2036..2429 372..760 393 27.7 Plus
Dana\GF21799-PA 4648 GF21799-PA 2372..2699 385..719 388 26.7 Plus
Dana\GF21799-PA 4648 GF21799-PA 2696..3028 22..336 348 37.2 Plus
Dana\GF21799-PA 4648 GF21799-PA 3534..3830 104..351 292 32.2 Plus
Dana\GF21799-PA 4648 GF21799-PA 1724..2059 384..710 251 22.9 Plus
Dana\GF18234-PA 1036 GF18234-PA 143..276 156..299 234 37.8 Plus
Dana\GF20503-PA 876 GF20503-PA 708..875 372..535 213 32.7 Plus
Dana\GF21799-PA 4648 GF21799-PA 203..302 27..120 163 44.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:27:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12223-PA 1035 GG12223-PA 180..1035 28..830 4140 92.3 Plus
Dere\GG12224-PA 1079 GG12224-PA 236..1061 26..822 3002 70.5 Plus
Dere\GG18978-PA 4502 GG18978-PA 887..1637 36..760 1202 37.6 Plus
Dere\GG17929-PA 2009 GG17929-PA 239..958 43..764 1166 39.1 Plus
Dere\GG18978-PA 4502 GG18978-PA 2599..3395 30..721 1116 33.6 Plus
Dere\GG23343-PA 4647 GG23343-PA 2675..3349 43..718 1030 36.3 Plus
Dere\GG18978-PA 4502 GG18978-PA 3523..4243 35..706 982 34.1 Plus
Dere\GG18978-PA 4502 GG18978-PA 5..538 171..718 702 31 Plus
Dere\GG17929-PA 2009 GG17929-PA 882..1286 372..788 572 35.1 Plus
Dere\GG17929-PA 2009 GG17929-PA 1499..1824 375..706 547 32.1 Plus
Dere\GG17929-PA 2009 GG17929-PA 1182..1519 365..711 487 35.2 Plus
Dere\GG18978-PA 4502 GG18978-PA 3394..3677 29..317 433 38.7 Plus
Dere\GG18978-PA 4502 GG18978-PA 494..879 325..729 427 27.1 Plus
Dere\GG18978-PA 4502 GG18978-PA 2226..2553 385..719 416 28.5 Plus
Dere\GG18978-PA 4502 GG18978-PA 1889..2283 372..760 394 28 Plus
Dere\GG18978-PA 4502 GG18978-PA 2494..2882 14..336 353 31.2 Plus
Dere\GG18978-PA 4502 GG18978-PA 3388..3684 104..351 293 32.2 Plus
Dere\GG18978-PA 4502 GG18978-PA 1563..1912 373..710 240 22 Plus
Dere\GG12223-PA 1035 GG12223-PA 144..335 156..317 235 32.7 Plus
Dere\GG18978-PA 4502 GG18978-PA 4..188 49..227 234 36.1 Plus
Dere\GG18978-PA 4502 GG18978-PA 23..186 29..189 189 33.7 Plus
Dere\GG18978-PA 4502 GG18978-PA 61..160 27..120 159 44.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23433-PA 1030 GH23433-PA 142..1030 28..830 3703 79.3 Plus
Dgri\GH23437-PA 1024 GH23437-PA 226..1011 28..829 3193 75 Plus
Dgri\GH24913-PA 4576 GH24913-PA 969..1719 36..760 1194 37.6 Plus
Dgri\GH12853-PA 2095 GH12853-PA 267..1004 30..718 1190 38.2 Plus
Dgri\GH24913-PA 4576 GH24913-PA 2676..3472 30..721 1096 32.9 Plus
Dgri\GH21081-PA 4620 GH21081-PA 2640..3324 38..718 1072 37.3 Plus
Dgri\GH24913-PA 4576 GH24913-PA 3588..4320 24..706 988 33.6 Plus
Dgri\GH24913-PA 4576 GH24913-PA 1..622 101..718 721 30.9 Plus
Dgri\GH12853-PA 2095 GH12853-PA 974..1378 372..788 552 34 Plus
Dgri\GH12853-PA 2095 GH12853-PA 1579..1914 366..706 546 32.4 Plus
Dgri\GH12853-PA 2095 GH12853-PA 1282..1686 372..785 528 32.9 Plus
Dgri\GH24913-PA 4576 GH24913-PA 3471..3754 29..317 447 39.9 Plus
Dgri\GH24913-PA 4576 GH24913-PA 1970..2359 372..759 422 28.9 Plus
Dgri\GH24913-PA 4576 GH24913-PA 578..961 325..729 414 27 Plus
Dgri\GH24913-PA 4576 GH24913-PA 2284..2630 372..719 386 27.7 Plus
Dgri\GH24913-PA 4576 GH24913-PA 3473..3745 72..337 384 36.7 Plus
Dgri\GH24913-PA 4576 GH24913-PA 2571..2959 14..336 355 30.9 Plus
Dgri\GH24913-PA 4576 GH24913-PA 924..1183 118..377 288 34.4 Plus
Dgri\GH24913-PA 4576 GH24913-PA 1644..1991 372..708 251 22.2 Plus
Dgri\GH23437-PA 1024 GH23437-PA 190..381 156..317 247 34.7 Plus
Dgri\GH24913-PA 4576 GH24913-PA 105..270 27..189 197 33.9 Plus
Dgri\GH24913-PA 4576 GH24913-PA 3487..3687 209..387 197 30.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
LpR1-PD 830 CG31094-PD 1..830 1..830 4646 100 Plus
LpR1-PL 978 CG31094-PL 176..978 28..830 4508 100 Plus
LpR1-PG 889 CG31094-PG 1..889 1..830 4419 91 Plus
LpR1-PR 868 CG31094-PR 68..868 28..830 4358 97 Plus
LpR1-PQ 976 CG31094-PQ 176..976 28..830 4358 97 Plus
LpR1-PL 978 CG31094-PL 136..384 112..365 434 37.9 Plus
LpR1-PR 868 CG31094-PR 28..274 112..365 434 37.4 Plus
LpR1-PL 978 CG31094-PL 136..343 151..371 335 34.5 Plus
LpR1-PR 868 CG31094-PR 19..150 229..378 185 30.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10346-PA 1017 GI10346-PA 170..1017 26..830 3745 82.2 Plus
Dmoj\GI10347-PA 1070 GI10347-PA 225..1052 26..822 3194 71.4 Plus
Dmoj\GI15973-PA 4555 GI15973-PA 951..1701 36..760 1175 38 Plus
Dmoj\GI14944-PA 2119 GI14944-PA 289..1026 30..718 1134 37.4 Plus
Dmoj\GI15973-PA 4555 GI15973-PA 2655..3451 30..721 1086 32.4 Plus
Dmoj\GI18681-PA 4639 GI18681-PA 2610..3343 31..718 1081 35 Plus
Dmoj\GI15973-PA 4555 GI15973-PA 3567..4299 24..706 970 33.1 Plus
Dmoj\GI15973-PA 4555 GI15973-PA 60..609 155..718 707 31.8 Plus
Dmoj\GI14944-PA 2119 GI14944-PA 996..1388 372..776 563 35 Plus
Dmoj\GI14944-PA 2119 GI14944-PA 1608..1936 372..706 531 31.6 Plus
Dmoj\GI14944-PA 2119 GI14944-PA 1304..1644 372..724 521 35.7 Plus
Dmoj\GI15973-PA 4555 GI15973-PA 3450..3771 29..367 453 38.5 Plus
Dmoj\GI15973-PA 4555 GI15973-PA 565..943 325..729 427 27.9 Plus
Dmoj\GI15973-PA 4555 GI15973-PA 1950..2365 372..784 398 28 Plus
Dmoj\GI15973-PA 4555 GI15973-PA 2264..2609 372..719 397 29 Plus
Dmoj\GI10346-PA 1017 GI10346-PA 132..327 112..317 380 43.8 Plus
Dmoj\GI15973-PA 4555 GI15973-PA 2550..2938 14..336 355 31.2 Plus
Dmoj\GI15973-PA 4555 GI15973-PA 3444..3724 104..337 281 31.2 Plus
Dmoj\GI10346-PA 1017 GI10346-PA 136..309 156..335 278 38.7 Plus
Dmoj\GI15973-PA 4555 GI15973-PA 1626..1973 372..710 267 22.7 Plus
Dmoj\GI15973-PA 4555 GI15973-PA 67..259 41..227 249 35.9 Plus
Dmoj\GI15973-PA 4555 GI15973-PA 939..1175 145..387 240 35.6 Plus
Dmoj\GI15973-PA 4555 GI15973-PA 96..243 31..168 189 35.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22297-PA 1096 GL22297-PA 197..1096 28..830 3739 80.2 Plus
Dper\GL22298-PA 1070 GL22298-PA 232..1057 26..820 3043 70.3 Plus
Dper\GL16648-PA 816 GL16648-PA 34..725 29..764 1141 36.5 Plus
Dper\GL16506-PA 3916 GL16506-PA 2012..2808 30..721 1100 33.3 Plus
Dper\GL11210-PA 4617 GL11210-PA 2598..3326 30..718 1085 35.4 Plus
Dper\GL16506-PA 3916 GL16506-PA 2936..3656 35..706 977 34.1 Plus
Dper\GL16506-PA 3916 GL16506-PA 2807..3090 29..317 431 38.9 Plus
Dper\GL16506-PA 3916 GL16506-PA 298..532 36..273 430 42 Plus
Dper\GL16506-PA 3916 GL16506-PA 1617..1966 372..719 413 28.9 Plus
Dper\GL16506-PA 3916 GL16506-PA 1303..1696 372..760 403 28.6 Plus
Dper\GL16506-PA 3916 GL16506-PA 1..290 451..729 386 29.7 Plus
Dper\GL16506-PA 3916 GL16506-PA 330..529 28..229 362 40.5 Plus
Dper\GL16506-PA 3916 GL16506-PA 1900..2295 7..336 350 30.1 Plus
Dper\GL16506-PA 3916 GL16506-PA 297..528 116..317 317 36.4 Plus
Dper\GL16506-PA 3916 GL16506-PA 365..532 24..187 299 40.6 Plus
Dper\GL16506-PA 3916 GL16506-PA 977..1326 372..710 262 23.4 Plus
Dper\GL16506-PA 3916 GL16506-PA 2809..2947 196..337 196 38 Plus
Dper\GL16648-PA 816 GL16648-PA 649..781 372..500 163 33.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27443-PC 822 GA27443-PC 1..822 1..825 3857 87.5 Plus
Dpse\GA27443-PD 923 GA27443-PD 1..923 1..825 3782 79.1 Plus
Dpse\GA27443-PE 1005 GA27443-PE 131..1005 18..825 3757 81.6 Plus
Dpse\GA27443-PB 1052 GA27443-PB 197..1052 28..825 3752 83.1 Plus
Dpse\GA27443-PA 1096 GA27443-PA 197..1096 28..830 3747 80.2 Plus
Dpse\GA27443-PB 1052 GA27443-PB 161..294 156..299 242 39.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10223-PA 883 GM10223-PA 1..883 1..830 4319 93.7 Plus
Dsec\GM10225-PA 1071 GM10225-PA 233..1058 26..820 3007 70 Plus
Dsec\GM11364-PA 1676 GM11364-PA 626..1344 28..760 1205 37.6 Plus
Dsec\GM22597-PA 1980 GM22597-PA 239..958 43..764 1166 39.1 Plus
Dsec\GM21016-PA 4717 GM21016-PA 2727..3407 38..718 1042 36.3 Plus
Dsec\GM11364-PA 1676 GM11364-PA 28..584 149..731 682 29.9 Plus
Dsec\GM22597-PA 1980 GM22597-PA 882..1286 372..788 573 35.1 Plus
Dsec\GM22597-PA 1980 GM22597-PA 1470..1795 375..706 549 32.1 Plus
Dsec\GM22597-PA 1980 GM22597-PA 1182..1431 365..616 411 36.6 Plus
Dsec\GM11364-PA 1676 GM11364-PA 41..233 41..227 256 36.2 Plus
Dsec\GM11364-PA 1676 GM11364-PA 1270..1619 373..710 250 22.3 Plus
Dsec\GM11364-PA 1676 GM11364-PA 68..231 29..189 191 33.7 Plus
Dsec\GM11364-PA 1676 GM11364-PA 106..205 27..120 161 44.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:27:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18174-PA 883 GD18174-PA 1..883 1..830 4319 93.7 Plus
Dsim\GD18176-PA 626 GD18176-PA 12..613 196..820 2496 76 Plus
Dsim\GD16065-PA 1626 GD16065-PA 527..1277 36..760 1172 37.9 Plus
Dsim\GD17251-PA 1704 GD17251-PA 244..963 43..764 1164 39.1 Plus
Dsim\GD15368-PA 1857 GD15368-PA 708..1389 43..711 912 34.3 Plus
Dsim\GD17251-PA 1704 GD17251-PA 887..1291 372..788 574 35.1 Plus
Dsim\GD17251-PA 1704 GD17251-PA 1187..1524 365..711 496 35.5 Plus
Dsim\GD16065-PA 1626 GD16065-PA 134..519 325..729 420 27.1 Plus
Dsim\GD17251-PA 1704 GD17251-PA 1504..1704 375..573 323 31.7 Plus
Dsim\GD16065-PA 1626 GD16065-PA 1..178 539..718 253 31.9 Plus
Dsim\GD16065-PA 1626 GD16065-PA 1203..1552 373..710 242 22.3 Plus
Dsim\GD18176-PA 626 GD18176-PA 12..147 31..165 196 35.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:27:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10197-PA 1071 GJ10197-PA 181..1071 26..830 3659 77.7 Plus
Dvir\GJ10198-PA 1019 GJ10198-PA 214..1008 26..829 3246 76.3 Plus
Dvir\GJ18862-PA 4631 GJ18862-PA 1025..1775 36..760 1214 38 Plus
Dvir\GJ18973-PA 1276 GJ18973-PA 211..948 30..718 1170 38.1 Plus
Dvir\GJ21697-PA 4618 GJ21697-PA 2588..3321 31..718 1103 35.7 Plus
Dvir\GJ18862-PA 4631 GJ18862-PA 2731..3527 30..721 1100 32.7 Plus
Dvir\GJ18862-PA 4631 GJ18862-PA 3655..4375 35..706 982 33.7 Plus
Dvir\GJ18862-PA 4631 GJ18862-PA 32..681 72..718 790 31.2 Plus
Dvir\GJ18973-PA 1276 GJ18973-PA 918..1262 372..724 570 37.2 Plus
Dvir\GJ18862-PA 4631 GJ18862-PA 3526..3847 29..367 452 38.5 Plus
Dvir\GJ18862-PA 4631 GJ18862-PA 2011..2415 353..760 420 29 Plus
Dvir\GJ18862-PA 4631 GJ18862-PA 663..1017 384..729 416 28.4 Plus
Dvir\GJ18862-PA 4631 GJ18862-PA 2340..2685 372..719 402 28.4 Plus
Dvir\GJ18862-PA 4631 GJ18862-PA 2682..3014 22..336 350 37.2 Plus
Dvir\GJ18862-PA 4631 GJ18862-PA 1700..2047 372..708 291 24 Plus
Dvir\GJ18862-PA 4631 GJ18862-PA 1013..1239 145..377 289 36.6 Plus
Dvir\GJ18862-PA 4631 GJ18862-PA 3520..3800 104..337 283 31.2 Plus
Dvir\GJ10198-PA 1019 GJ10198-PA 185..376 161..324 244 34.7 Plus
Dvir\GJ10198-PA 1019 GJ10198-PA 175..315 196..337 209 35.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14389-PA 1077 GK14389-PA 180..1077 28..830 3620 77.8 Plus
Dwil\GK14390-PA 1102 GK14390-PA 262..1100 29..820 3167 71.8 Plus
Dwil\GK25553-PA 4521 GK25553-PA 912..1662 36..760 1223 37.9 Plus
Dwil\GK17732-PA 2014 GK17732-PA 276..924 28..718 1161 38.4 Plus
Dwil\GK15819-PA 4637 GK15819-PA 2606..3336 31..718 1123 36 Plus
Dwil\GK25553-PA 4521 GK25553-PA 2621..3418 30..721 1101 33 Plus
Dwil\GK25553-PA 4521 GK25553-PA 3546..4266 35..706 982 34.1 Plus
Dwil\GK25553-PA 4521 GK25553-PA 24..572 155..718 710 32.2 Plus
Dwil\GK17732-PA 2014 GK17732-PA 894..1298 372..788 558 33.7 Plus
Dwil\GK17732-PA 2014 GK17732-PA 1506..1834 372..706 527 31.3 Plus
Dwil\GK17732-PA 2014 GK17732-PA 1202..1542 372..724 526 35.6 Plus
Dwil\GK25553-PA 4521 GK25553-PA 3417..3700 29..317 448 39.9 Plus
Dwil\GK25553-PA 4521 GK25553-PA 528..904 325..729 438 28.2 Plus
Dwil\GK25553-PA 4521 GK25553-PA 2248..2575 385..719 410 29.3 Plus
Dwil\GK25553-PA 4521 GK25553-PA 1913..2305 372..760 409 28.7 Plus
Dwil\GK14390-PA 1102 GK14390-PA 225..455 76..317 383 43 Plus
Dwil\GK25553-PA 4521 GK25553-PA 2516..2904 14..336 360 31.2 Plus
Dwil\GK25553-PA 4521 GK25553-PA 3409..3691 102..337 291 32.1 Plus
Dwil\GK25553-PA 4521 GK25553-PA 31..223 41..227 258 37.9 Plus
Dwil\GK25553-PA 4521 GK25553-PA 1587..1936 372..710 249 21.5 Plus
Dwil\GK25553-PA 4521 GK25553-PA 56..221 27..189 195 33.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10671-PA 922 GE10671-PA 1..922 1..830 4231 88.7 Plus
Dyak\GE10672-PA 1060 GE10672-PA 220..1053 26..825 3064 70.5 Plus
Dyak\GE17236-PA 2009 GE17236-PA 239..958 43..764 1170 39.1 Plus
Dyak\GE15450-PA 3879 GE15450-PA 1976..2772 30..721 1110 33.5 Plus
Dyak\GE19184-PA 4693 GE19184-PA 2715..3395 38..718 1049 36.8 Plus
Dyak\GE15450-PA 3879 GE15450-PA 2900..3620 35..706 980 34.1 Plus
Dyak\GE15450-PA 3879 GE15450-PA 29..677 72..718 805 30.8 Plus
Dyak\GE17236-PA 2009 GE17236-PA 882..1286 372..788 572 35.1 Plus
Dyak\GE17236-PA 2009 GE17236-PA 1499..1827 375..709 551 32.2 Plus
Dyak\GE17236-PA 2009 GE17236-PA 1182..1519 365..711 495 35.5 Plus
Dyak\GE15450-PA 3879 GE15450-PA 2771..3054 29..317 432 38.7 Plus
Dyak\GE15450-PA 3879 GE15450-PA 633..1018 325..729 427 27.1 Plus
Dyak\GE15450-PA 3879 GE15450-PA 1603..1930 385..719 419 28.5 Plus
Dyak\GE15450-PA 3879 GE15450-PA 1266..1660 372..760 395 28.3 Plus
Dyak\GE15450-PA 3879 GE15450-PA 1864..2259 7..336 353 30.7 Plus
Dyak\GE15450-PA 3879 GE15450-PA 1026..1163 36..174 312 47.3 Plus
Dyak\GE15450-PA 3879 GE15450-PA 2765..3061 104..351 291 32.2 Plus
Dyak\GE15450-PA 3879 GE15450-PA 1021..1163 74..219 282 41.6 Plus
Dyak\GE15450-PA 3879 GE15450-PA 1014..1161 145..306 264 42 Plus
Dyak\GE15450-PA 3879 GE15450-PA 1025..1163 116..260 243 41.1 Plus
Dyak\GE15450-PA 3879 GE15450-PA 1058..1163 28..134 229 45.5 Plus
Dyak\GE15450-PA 3879 GE15450-PA 1023..1131 198..317 214 40.8 Plus
Dyak\GE15450-PA 3879 GE15450-PA 200..299 27..120 157 43.1 Plus

FI11925.hyp Sequence

Translation from 244 to 2736

> FI11925.hyp
MGRIWCLLFVSSLLHTQSQSFRVLAINEATCSSDQFRCGNGNCIPNKWRC
DQESDCADGSDEANELCRARTCSPDEYACKSGEGQCVPLAWMCDQSKDCS
DGSDEHNCNQTCRADEFTCGNGRCIQKRWKCDHDDDCGDGSDEKECPVVP
CDSVAEHTCTNGACIAKRWVCDGDPDCSDGSDERSCANVTKTTTPCLSHE
YQCKDRITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQFQCGDRSC
IPGHLTCNGDKDCADGSDERDCGLSLSLGINQGGCNATSEFDCGGGQCVP
LSKVCDKRKDCPDGEDEPAGKCGINECASKNGGCMHQCIDLKVGHHCECH
EGYKLSPDKRNCQDINECEVPGKCSQICVNEIGGFKCECEAGYMRDPKNH
TRCKASEGHASLLLARRHDIRKIALDHMEMTSIVNSTKAATALDFVFRTG
MIFWSDVTTQSIYKAPIDEGNEKTVVLTKSSVTSDGLAVDWIYNHVYFTD
THKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWMYWSDWGASPRI
ERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDG
SQRSQVLYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPV
TAMHMLQHPMVVHVYHPYRQPDGVNHCQSVNGHCSHLCLPAPRINERSPR
ISCACPTGLKLMVDGLMCVEDLADQRPVKNHTQIEKTTTPSEQPDSGFIA
LVVIASLSGFAVLLSVLLLIGYRYCSKRRINSMNFENPIYRKTTTTEDHF
SLRKNLPARIYDHTSVMDEEYSPVIGISSY*

FI11925.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:51:21
Subject Length Description Subject Range Query Range Score Percent Strand
LpR1-PD 830 CG31094-PD 1..830 1..830 4646 100 Plus
LpR1-PL 978 CG31094-PL 176..978 28..830 4508 100 Plus
LpR1-PG 889 CG31094-PG 1..889 1..830 4419 91 Plus
LpR1-PR 868 CG31094-PR 68..868 28..830 4358 97 Plus
LpR1-PQ 976 CG31094-PQ 176..976 28..830 4358 97 Plus
LpR1-PL 978 CG31094-PL 136..384 112..365 434 37.9 Plus
LpR1-PR 868 CG31094-PR 28..274 112..365 434 37.4 Plus
LpR1-PL 978 CG31094-PL 136..343 151..371 335 34.5 Plus
LpR1-PR 868 CG31094-PR 19..150 229..378 185 30.9 Plus