Clone FI11937 Report

Search the DGRC for FI11937

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:119
Well:37
Vector:pFlc-1
Associated Gene/Transcriptcomm-RA
Protein status:FI11937.pep: gold
Sequenced Size:1684

Clone Sequence Records

FI11937.complete Sequence

1684 bp assembled on 2010-03-27

GenBank Submission: BT122139.1

> FI11937.complete
GGTCAACTTATAGCCGCTCCAGCGAACGGACGCACCGAAAATCGAGCTAT
AGAAACTCTACGGCAAATAAAAAACCCGAAATCGAACCCATGACTTATAT
ATAGAGCCAAACGATTTGTTTACGTGTCGTGACGCGAGTGTGCCAGCAGT
TGTGTGCGTGTGCCAGACGCAAGCAGAAAATAAAGTTTACAAATTAAAAT
AAATCAAAGGCAATCACCATGATTAGCACCACGGATTATCCAACAGTGGA
GACCACCACAACTGCCGAAGAGCTCTATGCGGAGTACATATCCGCGCCGG
CCAGCAGCATGAGTCCCGCTGCAATTGCCGAGCACCTGCAGCAGAATCAG
ATCACCTTCGAGATACCCAGTGCCCACGATCTGCGACACATCGACGCCCT
CAACTCCTTCAACGCCCTGCTCCAGAGGATTGGCAACGCAGCGGTGTCCT
ACGATCCCGCTCCACCCAGCGGCTGGTCTCCGGATGGCAGCATCAGCACC
GAGCAGCTCTCCAAGTCGGTGGTTCTGGATCTGGCCGACTTGCGGGATAG
GTCCGAGGAATCGGGCGAATCCTCGTGGTGGAGCCAGATCTTCGGGGATG
CCGACATGCATGTGATCATCAATTATCTGTGGATCGGAGTGGTCAGCTCG
CTGGTCATTCTGTCGCTGGTCTTCATCCTCTTCAGCTGCTACTTCTACAG
GAAGTTCCGCACTTGGAAAAAATGCAATAAGGACATACGTGCCCAGATCC
ATGCGGCCAGTGACTCGTACTCCTCGCACCTGGTTGGTTGCGATGCCAGC
AGACTGCTGTTGCACCAGCAGATGCAGCATCCACATCATCGGAGCAGCGA
GGCTGGGTTCTACCAAATCGAATCGCCGCCCTGCTACACAATCGCCACCG
GATTGCCCAGCTACGATGAGGCACTGCATCATCAGCCTCGGCACTTTGCC
TACGGCATGAAGTTCGTTTATCCCTCGTTGGCGGCCGTGCATCATCATCA
CCATTGCATTTCCAATTGGGAGAAGCAGGAGCCGCTGAATAAGCTGCAAA
AGTGCAAGCTGTCAGCGGCAGCGGCAGTGGAGGAGGATAAAGCCGACTCC
TCATCGTCCACGTCTGCATCCGCGTCGCCATCCTCTTCGGAATCCAGCAA
CTTGGCCACAGCAACGCCTGCCATTTGCATTAACATGCCAAGTGGGCGGC
AGGATGAGGAGGTGGATAATTCAGATTCCGATTCCGCAATTGCAGTTGCA
GTGGCAGTAGCACAAAGTTTACAGCCGGCGGCGCCTGCCGACGATGATTG
CGCCTCATTGGTCGTTGTTGTTGCCGCGTGATTGCCCACCCAGGGGTCAG
AGGTCAGGGAATAAGGGGTCAGTCGAGGGTTTAGGGCCGGGAGTAGCAGC
CCAATTGCTTAGTCACTTGTAAATAGTTGCATCGTCTGCTAATGTTGTTT
GCCCCATGTAATAACATATATCTCCGAGAATGTACCCTCTCCCTCCCTCT
AAGAAAATTTAGTTTTGGTTTTTAGTTATCTGTTATATATTATTGTATTA
CGCAAGACTGAGTATTATTTATTGTACTATGTATAAAACCGAATTGTCTA
TCGATTAAGCCCTAATATCTAAGCGAGAGTTGAAGAAAAAATATAAAACT
CGAATGAACACATTGCAAACAAAAAAAAAAAAAA

FI11937.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
comm-RA 1916 comm-RA 134..1806 2..1674 8350 99.9 Plus
comm.b 2527 comm.b 134..1806 2..1674 8350 99.9 Plus
comm.a 2478 comm.a 134..1806 2..1674 8350 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:09:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15712175..15713118 1670..727 4720 100 Minus
chr3L 24539361 chr3L 15717535..15718264 731..2 3635 99.9 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:09:39
Subject Length Description Subject Range Query Range Score Percent Strand
comm-RB 1113 CG17943-PB 1..1113 219..1331 5565 100 Plus
comm-RA 1113 CG17943-PA 1..1113 219..1331 5565 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:23:19 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:09:39
Subject Length Description Subject Range Query Range Score Percent Strand
comm-RB 2495 CG17943-RB 10..1678 2..1670 8345 100 Plus
comm-RA 1678 CG17943-RA 10..1678 2..1670 8345 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
comm-PB 370 CG17943-PB 38..363 330..1307 1191 100 Plus
comm-PA 370 CG17943-PA 38..363 330..1307 1191 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15722324..15723271 1674..727 4725 99.9 Minus
3L 28110227 3L 15727692..15728421 731..2 3635 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15715424..15716371 1674..727 4725 99.8 Minus
3L 28103327 3L 15720792..15721521 731..2 3635 99.8 Minus
Blast to na_te.dros performed on 2014-11-27 04:09:37 has no hits.

FI11937.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:37:56 Download gff for FI11937.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15717540..15718264 1..726 99   Minus
chr3L 15712175..15713118 727..1670 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-27 23:56:14 Download gff for FI11937.complete
Subject Subject Range Query Range Percent Splice Strand
comm-RA 1..1113 219..1331 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:58:03 Download gff for FI11937.complete
Subject Subject Range Query Range Percent Splice Strand
comm-RA 1..1113 219..1331 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:28:10 Download gff for FI11937.complete
Subject Subject Range Query Range Percent Splice Strand
comm-RA 1..1113 219..1331 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:37:56 Download gff for FI11937.complete
Subject Subject Range Query Range Percent Splice Strand
comm-RA 1..1113 219..1331 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-27 23:56:13 Download gff for FI11937.complete
Subject Subject Range Query Range Percent Splice Strand
comm-RA 2..1671 1..1670 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:58:03 Download gff for FI11937.complete
Subject Subject Range Query Range Percent Splice Strand
comm-RA 133..1802 1..1670 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:28:10 Download gff for FI11937.complete
Subject Subject Range Query Range Percent Splice Strand
comm-RA 9..1678 1..1670 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:37:56 Download gff for FI11937.complete
Subject Subject Range Query Range Percent Splice Strand
comm-RA 9..1678 1..1670 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:37:56 Download gff for FI11937.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15727697..15728421 1..726 99   Minus
3L 15722328..15723271 727..1670 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:28:10 Download gff for FI11937.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15720797..15721521 1..726 99   Minus
arm_3L 15715428..15716371 727..1670 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:34:55 Download gff for FI11937.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15720797..15721521 1..726 99   Minus
3L 15715428..15716371 727..1670 100 <- Minus

FI11937.pep Sequence

Translation from 218 to 1330

> FI11937.pep
MISTTDYPTVETTTTAEELYAEYISAPASSMSPAAIAEHLQQNQITFEIP
SAHDLRHIDALNSFNALLQRIGNAAVSYDPAPPSGWSPDGSISTEQLSKS
VVLDLADLRDRSEESGESSWWSQIFGDADMHVIINYLWIGVVSSLVILSL
VFILFSCYFYRKFRTWKKCNKDIRAQIHAASDSYSSHLVGCDASRLLLHQ
QMQHPHHRSSEAGFYQIESPPCYTIATGLPSYDEALHHQPRHFAYGMKFV
YPSLAAVHHHHHCISNWEKQEPLNKLQKCKLSAAAAVEEDKADSSSSTSA
SASPSSSESSNLATATPAICINMPSGRQDEEVDNSDSDSAIAVAVAVAQS
LQPAAPADDDCASLVVVVAA*

FI11937.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:16:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10376-PA 384 GF10376-PA 1..384 1..370 1328 72.9 Plus
Dana\GF10377-PA 329 GF10377-PA 13..217 52..262 169 27.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:16:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13521-PA 374 GG13521-PA 1..374 1..370 1660 92.3 Plus
Dere\GG13522-PA 342 GG13522-PA 101..256 117..320 167 28.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:16:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14475-PA 403 GH14475-PA 17..403 6..370 1047 59.7 Plus
Dgri\GH10044-PA 223 GH10044-PA 5..223 170..370 415 51.5 Plus
Dgri\GH10043-PA 118 GH10043-PA 15..106 6..100 318 69.6 Plus
Dgri\GH14476-PA 338 GH14476-PA 119..225 133..261 167 32.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:16:47
Subject Length Description Subject Range Query Range Score Percent Strand
comm-PB 370 CG17943-PB 1..370 1..370 1923 100 Plus
comm-PA 370 CG17943-PA 1..370 1..370 1923 100 Plus
comm2-PA 343 CG7554-PA 101..300 117..364 165 25.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:16:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13621-PA 387 GI13621-PA 3..387 1..370 1135 62.6 Plus
Dmoj\GI13622-PA 333 GI13622-PA 117..223 133..261 157 31.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:16:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25475-PA 393 GL25475-PA 1..393 1..370 1201 72.4 Plus
Dper\GL25481-PA 344 GL25481-PA 119..225 133..261 168 32.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:16:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14736-PA 391 GA14736-PA 1..391 1..370 1204 72.8 Plus
Dpse\GA20435-PA 348 GA20435-PA 119..225 133..261 168 32.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24465-PA 370 GM24465-PA 1..370 1..370 1941 98.6 Plus
Dsec\GM24466-PA 274 GM24466-PA 101..223 117..272 157 29.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12538-PA 370 GD12538-PA 1..370 1..370 1938 98.6 Plus
Dsim\GD12539-PA 339 GD12539-PA 101..233 117..272 165 30.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13957-PA 385 GJ13957-PA 5..385 2..370 1136 61.9 Plus
Dvir\GJ13958-PA 334 GJ13958-PA 116..222 133..261 161 31.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20663-PA 397 GK20663-PA 14..397 19..370 930 58.2 Plus
Dwil\GK20674-PA 361 GK20674-PA 126..248 117..259 162 30.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19813-PA 378 GE19813-PA 1..378 1..370 1744 93.7 Plus
Dyak\GE22823-PA 339 GE22823-PA 101..221 117..259 163 30.6 Plus
Dyak\GE19814-PA 341 GE19814-PA 101..221 117..259 163 30.6 Plus

FI11937.hyp Sequence

Translation from 218 to 1330

> FI11937.hyp
MISTTDYPTVETTTTAEELYAEYISAPASSMSPAAIAEHLQQNQITFEIP
SAHDLRHIDALNSFNALLQRIGNAAVSYDPAPPSGWSPDGSISTEQLSKS
VVLDLADLRDRSEESGESSWWSQIFGDADMHVIINYLWIGVVSSLVILSL
VFILFSCYFYRKFRTWKKCNKDIRAQIHAASDSYSSHLVGCDASRLLLHQ
QMQHPHHRSSEAGFYQIESPPCYTIATGLPSYDEALHHQPRHFAYGMKFV
YPSLAAVHHHHHCISNWEKQEPLNKLQKCKLSAAAAVEEDKADSSSSTSA
SASPSSSESSNLATATPAICINMPSGRQDEEVDNSDSDSAIAVAVAVAQS
LQPAAPADDDCASLVVVVAA*

FI11937.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:13:06
Subject Length Description Subject Range Query Range Score Percent Strand
comm-PB 370 CG17943-PB 1..370 1..370 1923 100 Plus
comm-PA 370 CG17943-PA 1..370 1..370 1923 100 Plus
comm2-PA 343 CG7554-PA 101..300 117..364 165 25.3 Plus