Clone FI11941 Report

Search the DGRC for FI11941

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:119
Well:41
Vector:pFlc-1
Associated Gene/TranscriptCG12945-RB
Protein status:FI11941.pep: gold
Sequenced Size:2071

Clone Sequence Records

FI11941.complete Sequence

2071 bp assembled on 2010-03-24

GenBank Submission: BT122112.1

> FI11941.complete
GGTGTTGCTAACTGGACTTGGTCACACTGCCAATTTGCATCAGCCGCCTT
ACCACGAAATTGCGCTGAATTATAATTATTATCGAGTGCTTACTACCTAG
GAGTGATTACATTGAGAAACCAGGACAATGAGAACGGAGGCAGCGGTCAG
TTGTTTCCTGTTGGTATTGCACAGGGTATGCTGTCAGAGCGGCAACGATG
AGTCCTGGCTGAGTCCGGATCCCGCCTGGTCGGACCTGGTTAACGATATC
AATCAGCCCGGTGAATTGTGCCAGTGTCCTACGTGTCCAGATGTGTCTCC
AGTGGCCATGGAGGATGCCGTGGCACTCACATACTTCAAGAAGTTCGTCA
ATCTGCTGTTCCAGCGCAAGCGTTTTCAGTACGATGTTATGTCGGCGGTC
CATAAGCGATCGCTGCTCTTCTCCCTGATCCCATCGCAACTGGATGAACT
GGAGAGGGTGCAGGATGCTCGGGATTTGGACGTTTTGCTGACTAAGATAT
TGGAGAGTGCCGAGGAGGCTCCTTTGTTTAATGGAAGATCCGGATGCTCA
TACGTCCGACACGGCTTTTTCTCCTTATTGGTGGATATTTTCAAGGATGT
AATTGAACTGACGCAAACGACCGAGGTGAAATTTATCCTATATGCAACAT
TAGCAATTGCACTTGTCGTCATTGTGCACAAACGTTTCCGTGTCGGACTA
ATTTCAATTGTACTAGGAGGCGTGTTTCTGTGCGGATATATTCAGACTTA
TTTAGAATGCAACAGAGAATTAGACATCGATAGGATGATAGAGGTCGTAA
ATCATCACCATGAGCCTGAATCGTCCTGGTTTGGTCGACTGTTAGGCTAC
ATATACCAAGCCTCACCAAAAACTAAGAAGATAGAAATGATCAAAAAATC
CGCAAAAATCAGCATTTCCATTTGCATGCCAGATCAAGTGTTCTTTATGT
ACATGAATAACATATTTATCAAGCAGTTGGAAATCATGATAGAAAAGGTG
TCGGTAACTATGACTAAACTGTCCTCCGGATTATCCTTCCCGTATAACCT
CCTTGCACCAGTCCTTTTGGTGTTTTTAGTGGGTTACACCATAAAGCTGT
GCTTTAAATACATTTTAAGCCCCCGAGCATGGGCGTCACTTTTACACAAG
CCAGCGCCACAAGGGACACCAACGATTCACCAGTCCATTAATGCACGGGC
GCCCGAAGGCGACTCCATATCGGGCGACAACTTAAAGATGCTGCTAAATG
TAATTAACGTGAGAAATGTTCCAAAGGAGTCGCTACAGCGAATTCCAGAC
GTTTCGGGCGTCCAAGAGCTAGAGGAAAAGCAGGAAGCTCCCACCACACC
ATCGAAAAAAGAAAATTTAGATGAAAGCGATTCCAGCAGCAAAAGCAAGA
GCAAAAGCTGTGTAGCTGAAGATGAAGGATTCACGCTGGTCGACGATCAC
GAGGATAATAACATTGATAATGTGTAGCGGCCGCAAACAAACAATTTGTA
ATTTAAGTGTAATGTCCGAGATTTTTACCCAGTTTATTAGAGACCATTTA
TGGTCGGCAAATAATTCAATTTTTTCATTTTTTGATTTGTCATAGTTAAA
TTTTTATTTAAATTATTTTGCATGTACTTAATCTCATTTGCGCGATAAGT
GTTATTAAGATAAATCTTCAACAATAAGATCTTTTAAGTAGGCCACGAAA
CTGTTTATATTTTGCTTGTTATTATTATGATGCCGGCCCTTCAAAAAATC
GGATATAATTTTTATATGTAACTTGTTGATCATTTATATTTACAACTTGG
CGCTCAGGCGATTATTAATAATAATATTATTAGCAGTGGGCGCTCATTTG
TGAGTTGCGTATTAATTGAATGTAAGCGATAATTAAATATTCGGTTTTCG
AATCTTGTAAAATCTAATTTAATATGTATACAACTAATATATTTATATAT
CTATGTATATAGATCTATATAGTGTGTGTATATACTTGTAAGAAAAAATT
AGAAAAGAATTTCGGTGTAAATATATTTATTCGTTGTATTTTAAATCATG
CACCCAAAAAAAAAAAAAAAA

FI11941.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG12945-RB 2213 CG12945-RB 102..2158 3..2059 10270 99.9 Plus
CG8500.b 3406 CG8500.b 2917..3406 2059..1570 2435 99.7 Minus
CG8500.a 3406 CG8500.a 2917..3406 2059..1570 2435 99.7 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5614689..5615717 2054..1026 5145 100 Minus
chr3R 27901430 chr3R 5616675..5617051 379..3 1885 100 Minus
chr3R 27901430 chr3R 5616360..5616609 627..378 1250 100 Minus
chr3R 27901430 chr3R 5616155..5616298 767..624 720 100 Minus
chr3R 27901430 chr3R 5615790..5615924 1025..891 660 99.3 Minus
chr3R 27901430 chr3R 5615974..5616101 894..767 640 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:53:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG12945-RB 1350 CG12945-PB 1..1350 128..1477 6750 100 Plus
CG12945-RC 1323 CG12945-PC 251..1323 405..1477 5365 100 Plus
CG12945-RC 1323 CG12945-PC 1..252 128..379 1260 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:23:20 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG12945-RB 2059 CG12945-RB 7..2058 3..2054 10260 100 Plus
CG12945-RC 2032 CG12945-RC 382..2031 405..2054 8250 100 Plus
CG8500-RA 3431 CG8500-RA 2961..3431 2054..1584 2355 100 Minus
CG12945-RC 2032 CG12945-RC 7..383 3..379 1885 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:53:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG12945-PB 449 CG12945-PB 1..449 128..1474 2096 100 Plus
CG12945-PC 440 CG12945-PC 1..440 128..1474 2029 98 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9788848..9789881 2059..1026 5155 99.9 Minus
3R 32079331 3R 9790839..9791215 379..3 1885 100 Minus
3R 32079331 3R 9790524..9790773 627..378 1250 100 Minus
3R 32079331 3R 9790319..9790462 767..624 720 100 Minus
3R 32079331 3R 9789954..9790088 1025..891 660 99.3 Minus
3R 32079331 3R 9790138..9790265 894..767 640 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:54:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9529679..9530712 2059..1026 5155 99.9 Minus
3R 31820162 3R 9531670..9532046 379..3 1885 100 Minus
3R 31820162 3R 9531355..9531604 627..378 1250 100 Minus
3R 31820162 3R 9531150..9531293 767..624 720 100 Minus
3R 31820162 3R 9530785..9530919 1025..891 660 99.2 Minus
3R 31820162 3R 9530969..9531096 894..767 640 100 Minus
Blast to na_te.dros performed on 2014-11-27 03:53:00 has no hits.

FI11941.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:02:51 Download gff for FI11941.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5616675..5617053 1..379 99   Minus
chr3R 5616362..5616607 380..625 100 <- Minus
chr3R 5616156..5616296 626..766 100 <- Minus
chr3R 5615974..5616101 767..894 100 <- Minus
chr3R 5615790..5615920 895..1025 100 <- Minus
chr3R 5614822..5615717 1026..1921 94 <- Minus
chr3R 5614688..5614758 1985..2055 98 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-24 12:35:31 Download gff for FI11941.complete
Subject Subject Range Query Range Percent Splice Strand
CG12945-RB 1..1350 128..1477 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:57:23 Download gff for FI11941.complete
Subject Subject Range Query Range Percent Splice Strand
CG12945-RB 1..1350 128..1477 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:17:44 Download gff for FI11941.complete
Subject Subject Range Query Range Percent Splice Strand
CG12945-RB 1..1350 128..1477 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:02:51 Download gff for FI11941.complete
Subject Subject Range Query Range Percent Splice Strand
CG12945-RB 1..1350 128..1477 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-24 12:35:31 Download gff for FI11941.complete
Subject Subject Range Query Range Percent Splice Strand
CG12945-RB 1..2054 2..2055 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:57:23 Download gff for FI11941.complete
Subject Subject Range Query Range Percent Splice Strand
CG12945-RB 1..2054 2..2055 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:17:44 Download gff for FI11941.complete
Subject Subject Range Query Range Percent Splice Strand
CG12945-RB 5..2058 1..2055 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:02:51 Download gff for FI11941.complete
Subject Subject Range Query Range Percent Splice Strand
CG12945-RB 5..2058 1..2055 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:02:51 Download gff for FI11941.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9790839..9791217 1..379 99   Minus
3R 9790526..9790771 380..625 100 <- Minus
3R 9790320..9790460 626..766 100 <- Minus
3R 9790138..9790265 767..894 100 <- Minus
3R 9789954..9790084 895..1025 100 <- Minus
3R 9788852..9789881 1026..2055 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:17:44 Download gff for FI11941.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5616561..5616939 1..379 99   Minus
arm_3R 5616248..5616493 380..625 100 <- Minus
arm_3R 5616042..5616182 626..766 100 <- Minus
arm_3R 5615860..5615987 767..894 100 <- Minus
arm_3R 5615676..5615806 895..1025 100 <- Minus
arm_3R 5614574..5615603 1026..2055 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:34:09 Download gff for FI11941.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9531670..9532048 1..379 99   Minus
3R 9531357..9531602 380..625 100 <- Minus
3R 9531151..9531291 626..766 100 <- Minus
3R 9530969..9531096 767..894 100 <- Minus
3R 9530785..9530915 895..1025 100 <- Minus
3R 9529683..9530712 1026..2055 99 <- Minus

FI11941.pep Sequence

Translation from 127 to 1476

> FI11941.pep
MRTEAAVSCFLLVLHRVCCQSGNDESWLSPDPAWSDLVNDINQPGELCQC
PTCPDVSPVAMEDAVALTYFKKFVNLLFQRKRFQYDVMSAVHKRSLLFSL
IPSQLDELERVQDARDLDVLLTKILESAEEAPLFNGRSGCSYVRHGFFSL
LVDIFKDVIELTQTTEVKFILYATLAIALVVIVHKRFRVGLISIVLGGVF
LCGYIQTYLECNRELDIDRMIEVVNHHHEPESSWFGRLLGYIYQASPKTK
KIEMIKKSAKISISICMPDQVFFMYMNNIFIKQLEIMIEKVSVTMTKLSS
GLSFPYNLLAPVLLVFLVGYTIKLCFKYILSPRAWASLLHKPAPQGTPTI
HQSINARAPEGDSISGDNLKMLLNVINVRNVPKESLQRIPDVSGVQELEE
KQEAPTTPSKKENLDESDSSSKSKSKSCVAEDEGFTLVDDHEDNNIDNV*

FI11941.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17151-PA 458 GF17151-PA 5..457 5..443 1291 55.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17323-PA 364 GG17323-PA 1..364 1..449 1286 59.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14292-PA 236 GH14292-PA 1..190 83..309 183 27 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG12945-PB 449 CG12945-PB 1..449 1..449 2316 100 Plus
CG12945-PC 440 CG12945-PC 1..440 1..449 2249 98 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24879-PA 300 GI24879-PA 1..170 1..166 350 46.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23227-PA 461 GL23227-PA 1..461 1..449 1185 53.6 Plus
Dper\GL23228-PA 463 GL23228-PA 1..463 1..449 1180 53.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:48:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11928-PA 465 GA11928-PA 1..465 1..449 1172 53.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:48:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26210-PA 317 GM26210-PA 1..218 1..265 965 70.6 Plus
Dsec\GM26210-PA 317 GM26210-PA 147..317 272..449 441 60.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20760-PA 254 GD20760-PA 1..191 1..191 939 91.1 Plus
Dsim\GD20760-PA 254 GD20760-PA 188..254 383..449 237 83.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24521-PA 463 GJ24521-PA 1..451 1..438 979 46.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11120-PA 405 GK11120-PA 17..405 17..449 805 43.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:48:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24727-PA 394 GE24727-PA 1..383 1..438 1421 68.5 Plus

FI11941.hyp Sequence

Translation from 127 to 1476

> FI11941.hyp
MRTEAAVSCFLLVLHRVCCQSGNDESWLSPDPAWSDLVNDINQPGELCQC
PTCPDVSPVAMEDAVALTYFKKFVNLLFQRKRFQYDVMSAVHKRSLLFSL
IPSQLDELERVQDARDLDVLLTKILESAEEAPLFNGRSGCSYVRHGFFSL
LVDIFKDVIELTQTTEVKFILYATLAIALVVIVHKRFRVGLISIVLGGVF
LCGYIQTYLECNRELDIDRMIEVVNHHHEPESSWFGRLLGYIYQASPKTK
KIEMIKKSAKISISICMPDQVFFMYMNNIFIKQLEIMIEKVSVTMTKLSS
GLSFPYNLLAPVLLVFLVGYTIKLCFKYILSPRAWASLLHKPAPQGTPTI
HQSINARAPEGDSISGDNLKMLLNVINVRNVPKESLQRIPDVSGVQELEE
KQEAPTTPSKKENLDESDSSSKSKSKSCVAEDEGFTLVDDHEDNNIDNV*

FI11941.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:58:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG12945-PB 449 CG12945-PB 1..449 1..449 2316 100 Plus
CG12945-PC 440 CG12945-PC 1..440 1..449 2249 98 Plus