Clone FI11950 Report

Search the DGRC for FI11950

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:119
Well:50
Vector:pFlc-1
Associated Gene/TranscriptCG5493-RA
Protein status:FI11950.pep: gold
Sequenced Size:1187

Clone Sequence Records

FI11950.complete Sequence

1187 bp assembled on 2010-02-08

GenBank Submission: BT120298.1

> FI11950.complete
GTTCGAATTTTGCGATCCGAGGTGGAGCGTGTGCGGTTAGTCGAAGCAAT
TCAATCAATTGTAACAGCAACGAATCGGAATATTCATATATATATATACC
AATAGCTATTATCAGCGATCATCGACTTTACAACGTAATTCATCTAAATC
AATTGAGCAGTGATCTTTATAGACTTTATAGGTCAATCAGAGCAAGCCCA
AAATGGCCCTGTCCAAGATCGACACCGAGATCGAGCAGGTTGACCAGGAG
AAGTACCTGCGTCAGGCCACTAGCTACTATCAGCCGCTGGAGAAACCCCT
GAAATACGGACCGGAGGTGAATTCCCTATCGGACTTGGTGGCCGCCCTTC
ACCGGGAATTCGAGTCGAACTATGTTAACATCGAGATGGTGAATCACCTT
ATGCTCAGCTACAAGTCCAATCCGCGGGAGTGGCGCAAATATGCCAAGTT
CGATCGTTACACCTACACGCGGAATCTCGTGGATGCTGGCAATGGAAAGT
TCAATCTGCTGATTCTGTGCTGGGGCGAAGGACACGGCTCCTCGGTGCAC
GACCATGCCGATTCCCATTGCTTCATGAAGATGCTGAAGGGTGATCTGCG
CGAGAAGCGCTACGAGTATCCCAATAGATCTGCCAGGGACAACGGCCGGT
CCCATCATCCCGATGGCGAGATCGATAGCCGAGAGCTGGTGGAGATTGGG
GAGACACCAATCGCCGTCAATGATGTGGCCTACATAAATGACAATCTGGG
TCTGCATCGCGTGGAGAACCCCAGCCATTCGGATACCTCTGTCTCCCTTC
ACCTATACTGTCCACCCTTCGACACGTGCTCCGTGTTCCAGGACAACCTG
AAGAAGACCACCGCCAAGGTCACCTTCTGGAGCAAATACGGCGTGAGGAC
GAAGCAGAACGAGCAGTAGATCCATCAAGATCCTAAAAATATAGCCTCTC
GTATTGTTGCATAATACTAAGAATCTTTATTACTAGATATTTAATGAGCT
AGGGCCTAAGAAGATCCGGGAGCTGAGCTATCAAACATGGCGAGCAAGGG
CCACGTTGGCGCTGATAAGTTCCCATTCCAATCCATTGGCTATCCCGGAT
CACAGCAGCGATTAGTGTACTTTAAGTGTTAGCTGTACCAAAAATATTCA
ATAAATAAGTGAACCATTGACAAAAAAAAAAAAAAAA

FI11950.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG5493-RA 1169 CG5493-RA 1..1169 1..1169 5845 100 Plus
CG5493.a 1059 CG5493.a 69..1059 181..1171 4955 100 Plus
CG5327-RA 2137 CG5327-RA 1030..1580 729..179 2755 100 Minus
CG5327-RA 2137 CG5327-RA 565..998 1173..740 2170 100 Minus
CG5327-RA 2137 CG5327-RA 1649..1831 183..1 915 100 Minus
CG5493.a 1059 CG5493.a 35..71 1..37 185 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14504323..14504884 740..179 2720 98.9 Minus
chr2R 21145070 chr2R 14503815..14504246 1171..740 2160 100 Minus
chr2R 21145070 chr2R 14504953..14505135 183..1 915 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:46:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG5493-RD 717 CG5493-PD 1..717 203..919 3585 100 Plus
CG5493-RC 717 CG5493-PC 1..717 203..919 3585 100 Plus
CG5493-RB 717 CG5493-PB 1..717 203..919 3585 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:23:22 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG5493-RA 1177 CG5493-RA 7..1177 1..1171 5855 100 Plus
CG5493-RD 1031 CG5493-RD 41..1031 181..1171 4955 100 Plus
CG5493-RB 1161 CG5493-RB 171..1161 181..1171 4955 100 Plus
CG5493-RD 1031 CG5493-RD 7..43 1..37 185 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG5493-PD 238 CG5493-PD 1..238 203..916 1282 100 Plus
CG5493-PC 238 CG5493-PC 1..238 203..916 1282 100 Plus
CG5493-PB 238 CG5493-PB 1..238 203..916 1282 100 Plus
CG5493-PA 238 CG5493-PA 1..238 203..916 1282 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:46:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18617200..18617761 740..179 2810 100 Minus
2R 25286936 2R 18616690..18617123 1173..740 2170 100 Minus
2R 25286936 2R 18617830..18618012 183..1 915 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18618399..18618960 740..179 2810 100 Minus
2R 25260384 2R 18617889..18618322 1173..740 2170 100 Minus
2R 25260384 2R 18619029..18619211 183..1 915 100 Minus
Blast to na_te.dros performed on 2014-11-27 03:46:35 has no hits.

FI11950.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:30:37 Download gff for FI11950.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14504955..14505135 1..181 100   Minus
chr2R 14504323..14504881 182..740 98 <- Minus
chr2R 14503815..14504245 741..1171 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-08 10:09:24 Download gff for FI11950.complete
Subject Subject Range Query Range Percent Splice Strand
CG5493-RA 1..717 203..919 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:21:25 Download gff for FI11950.complete
Subject Subject Range Query Range Percent Splice Strand
CG5493-RA 1..717 203..919 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:20:27 Download gff for FI11950.complete
Subject Subject Range Query Range Percent Splice Strand
CG5493-RB 1..717 203..919 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:30:37 Download gff for FI11950.complete
Subject Subject Range Query Range Percent Splice Strand
CG5493-RB 1..717 203..919 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-08 10:09:23 Download gff for FI11950.complete
Subject Subject Range Query Range Percent Splice Strand
CG5493-RA 1..1169 1..1169 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:21:25 Download gff for FI11950.complete
Subject Subject Range Query Range Percent Splice Strand
CG5493-RA 1..1169 1..1169 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:20:27 Download gff for FI11950.complete
Subject Subject Range Query Range Percent Splice Strand
CG5493-RA 7..1177 1..1171 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:30:37 Download gff for FI11950.complete
Subject Subject Range Query Range Percent Splice Strand
CG5493-RA 7..1177 1..1171 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:30:37 Download gff for FI11950.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18617832..18618012 1..181 100   Minus
2R 18617200..18617758 182..740 100 <- Minus
2R 18616692..18617122 741..1171 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:20:27 Download gff for FI11950.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14505337..14505517 1..181 100   Minus
arm_2R 14504705..14505263 182..740 100 <- Minus
arm_2R 14504197..14504627 741..1171 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:09:35 Download gff for FI11950.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18619031..18619211 1..181 100   Minus
2R 18618399..18618957 182..740 100 <- Minus
2R 18617891..18618321 741..1171 100 <- Minus

FI11950.pep Sequence

Translation from 202 to 918

> FI11950.pep
MALSKIDTEIEQVDQEKYLRQATSYYQPLEKPLKYGPEVNSLSDLVAALH
REFESNYVNIEMVNHLMLSYKSNPREWRKYAKFDRYTYTRNLVDAGNGKF
NLLILCWGEGHGSSVHDHADSHCFMKMLKGDLREKRYEYPNRSARDNGRS
HHPDGEIDSRELVEIGETPIAVNDVAYINDNLGLHRVENPSHSDTSVSLH
LYCPPFDTCSVFQDNLKKTTAKVTFWSKYGVRTKQNEQ*

FI11950.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12941-PA 238 GF12941-PA 1..238 1..238 1199 92 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20963-PA 238 GG20963-PA 1..238 1..238 1274 98.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:21:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21607-PA 241 GH21607-PA 1..241 1..238 1079 82.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG5493-PD 238 CG5493-PD 1..238 1..238 1282 100 Plus
CG5493-PC 238 CG5493-PC 1..238 1..238 1282 100 Plus
CG5493-PB 238 CG5493-PB 1..238 1..238 1282 100 Plus
CG5493-PA 238 CG5493-PA 1..238 1..238 1282 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19578-PA 241 GI19578-PA 1..241 1..238 1014 78 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17444-PA 252 GL17444-PA 9..252 1..238 932 74.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:21:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18925-PB 242 GA18925-PB 1..242 1..238 1136 86 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:21:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19895-PA 238 GM19895-PA 1..238 1..238 1276 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:21:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25380-PA 238 GD25380-PA 1..238 1..238 1284 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:21:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21153-PA 248 GJ21153-PA 1..248 1..238 1043 79.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:21:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21356-PA 244 GK21356-PA 1..244 1..238 1091 82 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:21:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13903-PA 238 GE13903-PA 1..238 1..238 1274 98.3 Plus

FI11950.hyp Sequence

Translation from 202 to 918

> FI11950.hyp
MALSKIDTEIEQVDQEKYLRQATSYYQPLEKPLKYGPEVNSLSDLVAALH
REFESNYVNIEMVNHLMLSYKSNPREWRKYAKFDRYTYTRNLVDAGNGKF
NLLILCWGEGHGSSVHDHADSHCFMKMLKGDLREKRYEYPNRSARDNGRS
HHPDGEIDSRELVEIGETPIAVNDVAYINDNLGLHRVENPSHSDTSVSLH
LYCPPFDTCSVFQDNLKKTTAKVTFWSKYGVRTKQNEQ*

FI11950.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG5493-PD 238 CG5493-PD 1..238 1..238 1282 100 Plus
CG5493-PC 238 CG5493-PC 1..238 1..238 1282 100 Plus
CG5493-PB 238 CG5493-PB 1..238 1..238 1282 100 Plus
CG5493-PA 238 CG5493-PA 1..238 1..238 1282 100 Plus