Clone FI11953 Report

Search the DGRC for FI11953

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:119
Well:53
Vector:pFlc-1
Associated Gene/TranscriptPHGPx-RD
Protein status:FI11953.pep: gold
Sequenced Size:991

Clone Sequence Records

FI11953.complete Sequence

991 bp assembled on 2009-08-28

GenBank Submission: BT099660.1

> FI11953.complete
GATTTACGCTTCGAAAGTGAGAAAGTGCCCAGTTCCATTAGTCATTGCTA
TTACGCCATAACATTTAAAGAATGAGTCTCAGGCAGTTTCAGAACATTTC
CCGCCAGGCCCTCAGGTGCTACTCGATGAGGCGGACCCCTGGCCCCGTCC
TCGAGCTGAGTCGCGGTCAGAGGCAGTGCCTTCGCCTCTGCACCATCATG
CTTCCCGTGAGCTGTGCGGCCACGCCCATGAACGCCATCTCCTCAGCCGC
CCAGCACTCCACAGCAGCTGCCATCGACATGTCTGCTAACGGAGATTACA
AGAACGCCGCCTCGATCTACGAGTTCACCGTGAAGGATACCCATGGCAAC
GATGTTTCCCTGGAAAAGTACAAGGGCAAGGTGGTCCTGGTGGTGAACAT
CGCCTCCAAGTGCGGCCTGACCAAGAACAACTACGAGAAGCTGACGGATC
TAAAGGAGAAGTACGGCGAGCGCGGCCTGGTGATCCTCAACTTCCCGTGC
AATCAGTTTGGGTCCCAGATGCCGGAGGCCGATGGAGAGGCCATGGTGTG
CCACCTGCGCGACTCCAAGGCTGACATCGGCGAGGTGTTCGCCAAGGTCG
ATGTGAATGGAGACAATGCGGCGCCGCTGTACAAATACCTAAAGGCCAAG
CAGACCGGCACCCTGGGCAGCGGAATCAAGTGGAACTTCACCAAGTTTCT
GGTGAACAAGGAGGGCGTGCCCATCAACCGATATGCCCCGACCACCGATC
CCATGGACATCGCCAAGGACATTGAAAAGCTGCTGTAGATGTGCCCTAGA
CGTTAGCTGCTCTTTTGGACTGTGTTTTCGCGTAGCTTTAGCTTGTAACC
GGCTGGCCACAGATAGTCTTGTGGCCGGCCACATGCACCGCATGGTATAT
ATATTGTCTACTCCTTACTGGTTTTGATTCCCACCCGCAAACATAATAAA
CGCCATTCGTGGTTACCACACTAAGAAAAAAAAAAAAAAAA

FI11953.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:33:51
Subject Length Description Subject Range Query Range Score Percent Strand
PHGPx-RD 1078 PHGPx-RD 59..1030 2..973 4845 99.8 Plus
PHGPx-RC 1212 PHGPx-RC 464..1164 273..973 3490 99.8 Plus
PHGPx-RA 867 PHGPx-RA 119..819 273..973 3490 99.8 Plus
PHGPx-RC 1212 PHGPx-RC 59..118 2..61 300 100 Plus
PHGPx-RA 867 PHGPx-RA 59..118 2..61 300 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 22:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3327656..3328034 595..973 1880 99.7 Plus
chr3L 24539361 chr3L 3327267..3327592 273..598 1585 99.1 Plus
chr3L 24539361 chr3L 3326761..3326971 62..272 1055 100 Plus
chr3L 24539361 chr3L 3325717..3325776 2..61 270 96.7 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
PHGPx-RD 717 CG12013-PD 1..717 72..788 3585 100 Plus
PHGPx-RC 597 CG12013-PC 82..597 273..788 2580 100 Plus
PHGPx-RA 510 CG12013-PA 1..510 279..788 2550 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:23:23 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
PHGPx-RD 1014 CG12013-RD 44..1014 2..972 4840 99.9 Plus
PHGPx-RA 803 CG12013-RA 104..803 273..972 3485 99.9 Plus
PHGPx-RC 1148 CG12013-RC 449..1148 273..972 3485 99.9 Plus
PHGPx-RA 803 CG12013-RA 44..103 2..61 300 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
PHGPx-PD 238 CG12013-PD 1..238 72..785 1237 100 Plus
PHGPx-PC 198 CG12013-PC 28..198 273..785 897 100 Plus
PHGPx-PA 169 CG12013-PA 1..169 279..785 887 100 Plus
CG15116-PA 193 CG15116-PA 33..191 294..785 403 50.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3328249..3328627 595..973 1880 99.7 Plus
3L 28110227 3L 3327860..3328185 273..598 1630 100 Plus
3L 28110227 3L 3327343..3327553 62..272 1055 100 Plus
3L 28110227 3L 3326308..3326367 2..61 300 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3328249..3328627 595..973 1880 99.7 Plus
3L 28103327 3L 3327860..3328185 273..598 1630 100 Plus
3L 28103327 3L 3327343..3327553 62..272 1055 100 Plus
3L 28103327 3L 3326308..3326367 2..61 300 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:53:57 has no hits.

FI11953.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:19:00 Download gff for FI11953.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3327658..3328034 597..975 99   Plus
chr3L 3327267..3327590 273..596 99 -> Plus
chr3L 3326761..3326971 62..272 100 -> Plus
chr3L 3325716..3325776 1..61 95 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:15:00 Download gff for FI11953.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RD 1..717 72..788 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:51:55 Download gff for FI11953.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RD 1..717 72..788 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:27:24 Download gff for FI11953.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RD 1..717 72..788 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:19:00 Download gff for FI11953.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RD 1..717 72..788 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-28 09:50:14 Download gff for FI11953.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RD 11..982 1..972 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:51:55 Download gff for FI11953.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RD 11..982 1..972 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:27:24 Download gff for FI11953.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RD 43..1014 1..972 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:19:00 Download gff for FI11953.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RD 43..1014 1..972 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:19:00 Download gff for FI11953.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3328251..3328627 597..975 99   Plus
3L 3327860..3328183 273..596 100 -> Plus
3L 3327343..3327553 62..272 100 -> Plus
3L 3326307..3326367 1..61 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:27:24 Download gff for FI11953.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3328251..3328627 597..975 99   Plus
arm_3L 3327860..3328183 273..596 100 -> Plus
arm_3L 3327343..3327553 62..272 100 -> Plus
arm_3L 3326307..3326367 1..61 98 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:28:02 Download gff for FI11953.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3328251..3328627 597..975 99   Plus
3L 3327860..3328183 273..596 100 -> Plus
3L 3327343..3327553 62..272 100 -> Plus
3L 3326307..3326367 1..61 98 -> Plus

FI11953.pep Sequence

Translation from 71 to 787

> FI11953.pep
MSLRQFQNISRQALRCYSMRRTPGPVLELSRGQRQCLRLCTIMLPVSCAA
TPMNAISSAAQHSTAAAIDMSANGDYKNAASIYEFTVKDTHGNDVSLEKY
KGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQFGSQM
PEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYLKAKQTGTLGS
GIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL*

FI11953.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10532-PA 240 GF10532-PA 1..240 1..238 1064 82.9 Plus
Dana\GF13732-PA 195 GF13732-PA 40..191 82..238 451 53.5 Plus
Dana\GF20161-PA 187 GF20161-PA 5..103 101..238 372 58 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15132-PA 265 GG15132-PA 28..265 1..238 1130 95.4 Plus
Dere\GG20925-PA 193 GG20925-PA 33..191 75..238 433 51.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15953-PA 245 GH15953-PA 1..245 1..238 957 75.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
PHGPx-PD 238 CG12013-PD 1..238 1..238 1237 100 Plus
PHGPx-PC 198 CG12013-PC 28..198 68..238 897 100 Plus
PHGPx-PA 169 CG12013-PA 1..169 70..238 887 100 Plus
CG15116-PA 193 CG15116-PA 33..191 75..238 403 50.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16605-PA 213 GI16605-PA 32..213 56..238 900 89.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16141-PA 238 GL16141-PA 1..238 1..238 1061 80.7 Plus
Dper\GL10571-PA 201 GL10571-PA 11..196 42..238 461 46.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11336-PA 238 GA11336-PA 1..238 1..238 1061 80.7 Plus
Dpse\GA13504-PA 201 GA13504-PA 37..196 79..238 462 53.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14565-PA 253 GM14565-PA 16..253 1..238 1191 92.4 Plus
Dsec\GM19853-PA 193 GM19853-PA 33..191 75..238 424 50 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13757-PA 196 GD13757-PA 16..190 1..175 851 89.7 Plus
Dsim\GD25340-PA 193 GD25340-PA 33..191 75..238 426 50.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12858-PA 244 GJ12858-PA 1..244 1..238 944 73.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20508-PA 254 GK20508-PA 27..254 5..238 1024 80 Plus
Dwil\GK19311-PA 194 GK19311-PA 39..190 81..238 432 51.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:19:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21358-PA 265 GE21358-PA 28..265 1..238 1129 95 Plus
Dyak\GE13862-PA 193 GE13862-PA 39..191 81..238 437 52.5 Plus

FI11953.hyp Sequence

Translation from 71 to 787

> FI11953.hyp
MSLRQFQNISRQALRCYSMRRTPGPVLELSRGQRQCLRLCTIMLPVSCAA
TPMNAISSAAQHSTAAAIDMSANGDYKNAASIYEFTVKDTHGNDVSLEKY
KGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQFGSQM
PEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYLKAKQTGTLGS
GIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL*

FI11953.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
PHGPx-PD 238 CG12013-PD 1..238 1..238 1237 100 Plus
PHGPx-PC 198 CG12013-PC 28..198 68..238 897 100 Plus
PHGPx-PA 169 CG12013-PA 1..169 70..238 887 100 Plus
CG15116-PA 193 CG15116-PA 33..191 75..238 403 50.6 Plus