Clone FI12817 Report

Search the DGRC for FI12817

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:128
Well:17
Vector:pFlc-1
Associated Gene/TranscriptNrx-IV-RB
Protein status:FI12817.pep: gold
Sequenced Size:4950

Clone Sequence Records

FI12817.complete Sequence

4950 bp assembled on 2009-12-04

GenBank Submission: BT120004.1

> FI12817.complete
GTGTGTCATCCGCGTTGCGATAATTATTTTCTTAATTCAAACGAAACTCT
TCCGAAGTGGGCGTGATCTGCTGGAGCCGTACACCCAGTGGATAAATTAC
ATAAATTCAAAATCGATTTAAAGCGGAGCGTAAAGTGCAGTCCAACGTTT
TTAACACCGCGGACGCGTTGCCACAAATCATCAGCTTTTCACGGTGGTTT
TTCCAGCGGAAAAGTGCATTTTGGTGTTAAACTTCTTCGGAAATCGAATA
TAGATGTGTTTATAAATCTACCAAGCGATAGTGTTTAATTAACAGCCTCC
AAGATGAGGCCGCCCAGGAGCAATACGAAAGCAGCATTTTCCTCGCTTCA
GTTTGGATTGTTATGCCTCCTATTGCTGGTCAATAATGGCATTAAATCGG
TGCAAGCAGACGCCTTCACGGACTATTTCTCCGACTACGATTGCAACCAG
CCGCTGATGGAAAGAGCCGTCCTCACGGCCACATCATCCTTGACGGAAAG
AGGACCCGACAAAGCACGACTAAACGCTGGCACCTCGTGGTCCGCGAAGA
ACTCGGATTTCGACCAGCGTCTGATTATTGACCTGGGCGTGGTGCGGAAC
GTGACGCACATCGCCCTGCAAGGACGACCACATAGCAATGAGTACGTCAC
CGAGTACACCATTAGCTATGGCATAACCGATCTAGAGTTTGCCGACTATA
AAGAGCCGGGCGGCAATGTCAAGATGTTCAAGGGCAACTCCGATGGCAAC
TCTATCCATTACAACGTCTTCGAGGTGCCCATTATTGCCCAATGGGTGAG
GATCAATCCCACCAGGTGGCACGATCGTATTTCCATGCGTGTGGAGCTCT
ACGGCTGCGATTACATCTCTGAAAACCTATACTTTAATGGCACTGGCTTG
GTGCGCTATGATCTGAGGCGGGAACCCATTACCTCCACCAAAGAGTCCAT
CCGCTTCCGCTTCAAGACGGCCTTTGCCAACGGAGTGATGATGTATTCGC
GTGGCACACAAGGGGATTACTATGCCCTGCAGCTTAAGGACAACAAAATG
GTGCTGAATTTGGATTTGGGATCGCGGGTGATGACCTCCTTATCGGTGGG
CAGCCTGCTGGATGATAATGTGTGGCATGACGTTGTGATCTCAAGGAATC
AAAGGGACATAATCTTCTCAGTGGATCGTGTCATCGTAAGAGGACGCATC
CAAGGCGAGTTCACACGACTGAATCTTAATAGGGAGCTGTATCTAGGTGG
TGTGCCCAACGTACAAGAGGGCTTGATTGTCCAACAAAATTTCTCCGGCT
GCTTAGAAAACATCTACTTTAATTCGACCAACTTTATTCGAGTGATGAAA
GACAGCACTGAACTGGGAGAGGGATATCTCTTCACTAGGGTAAACACGAT
CTACGCGTGTCCTTCGCCTCCGATTTATCCGGTGACCTTCACTACCCGTT
CGTCGTTCGTCCGTTTGAAGGGTTATGAAAATTCGCAGCGTCTTAACGTC
TCCTTCTATTTCCGTACTTACGAGGAAACTGGAGTAATGCTGCATCACGA
CTTCTATTCGGGTGGTTATCTAAAGGTCTTTTTGGAGTTTGGCAAAGTGA
AAATTGATCTTAAAGTCAAGGACAAAGCGCGAATCATTCTGGACAACTAC
GATGATCAGTTCAATGATGGCAAATGGCATTCGTTCGTTATATCCATCGA
AAAGAATCGCTTGATTTTAAATATTGATCAGAGACCGATGACCACAACAA
AGAGCATGCAGGTTGCCACTGGAGCACAGTACTATATTGCTGGTGGAAAG
GACAAAAATGGATTTGTCGGTTGCATGCGCTTAATTTCGGTGGATGGAAA
TTACAAATTACCGCAGGACTGGGTGAAGGGCGAGGAGGTTTGCTGTGGCG
ATGATGTCGTCGTCGATGCCTGCCAGATGATTGATCGCTGCAACCCGAAT
CCTTGCCAGCATAAGGGACTTTGTCACCAAAACTCCAGGGAGTTCTTCTG
TGATTGCGGACATACTGGCTACGCCGGAGCTGTTTGCCATACATCAAACA
ATCCATTGTCCTGCTTGGCTCTCAAGAATGTCCAGCATGTGCAGCAGCGT
GTGAACTTGAATCTCGATGTGGATGGCAGTGGTCCCCTAGAACCTTTCCC
AGTGACCTGCGAGTTCTACTCGGATGGACGCGTGATTACCACCCTCAGTC
ACAGTCAAGAGCACACCACAACAGTAGATGGTTTTCAGGAGCCTGGCTCC
TTTGAGCAGTCCATCATGTACGATGCCAACCAACTGCAAATTGAAGCTCT
GTTGAATCGGTCTCATAGCTGCTGGCAGCGCCTGAGCTACTCCTGCCGCT
CCTCCCGACTCTTCAACTCGCCATCTGAGGCCGGAAATTTCCGTCCCTTC
TCTTGGTGGATATCTCGCCACAATCAACCGATGGACTATTGGGCTGGAGC
TCTACCTGGCTCTCGTAAGTGCGAATGTGGAATTCTGGGCAAGTGTCACG
ATCCCACAAAGTGGTGCAACTGCGATTCGAACAGTCTGGAATGGATGGAG
GATGGTGGTGATATCCGGGAGAAGGAATACCTTCCCGTGCGAGCTGTGAA
GTTTGGCGACACTGGAACTCCGTTGGACGAGAAAATGGGTCGCTATACTC
TGGGACCGCTGCGCTGTGAGGGCGATGATCTGTTCAGTAATGTGGTGACC
TTCCGCATTGCCGATGCTTCTATTAACTTACCACCATTCGATATGGGTCA
CTCTGGAGATATTTATCTGGAATTCCGTACCACACAAGAGAACTCTGTGA
TCTTCCATGCTACCGGACCTACAGATTACATTAAGCTAAGTCTCAATGGC
GGCAACAAATTGCAATTCCAGTATCAGGCGGGAAGTGGTCCACTGGGCGT
TAATGTGGGCACAAGCTATCACCTGAACGACAACAACTGGCACACGGTTA
GTGTCGAGCGCAACAGGAAGGAGGCTCGTCTGGTGGTTGATGGTTCTATC
AAGGCTGAGGTTCGAGAGCCGCCGGGTCCAGTGCGTGCACTTCACTTAAC
ATCGGATCTGGTGATTGGCGCCACTACTGAGTACCGCGATGGTTACGTAG
GATGCATTCGTGCACTGCTGCTGAACGGAAAGATGGTTGACTTGAAGGAA
TACTCCAAGCGTGGATTATACGGCATCAGCACCGGTTGCGTGGGTCGCTG
TGAATCAAATCCATGCCTAAACAATGGTACTTGTATCGAGCGATACGATG
GCTACAGCTGCGATTGCCGTTGGAGCGCATTCAAAGGACCTATTTGCGCA
GATGAGATTGGTGTCAACCTACGCTCCAGTTCGATTATTCGCTACGAGTT
CGAGGGTTCCTTCCGCTCCACAATTGCCGAGAACATTCGCGTCGGTTTCA
CCACCACCATTCCGAAGGGATTCCTGCTTGGCTTCTCTTCCAACCTAACT
GGCGAATATTTAACTATTCAAATATCGAATTCTGGTCATTTGCGTTGTGT
ATTTGATTTCGGTTTCGAGAGGCAGGAAATCATATTCCCCAAAAAACATT
TTGGCCTGGGTCAGTACCACGATATGCACTTTATGCGCAAGAATGGTGGA
TCCACAGTGGTTTTGAAGGTTGACAACTACGAGCCGGTCGAGTATAATTT
TGATATTAAGGCCTCAGCGGATGCTCAATTCAACAATATCCAGTACATGT
ACATTGGCAAAAATGAATCTATGACAGATGGCTTTGTGGGTTGTGTGTCG
CGAGTTCAATTCGATGATATCTATCCACTGAAGCTGATGTTCCAGCAGAA
TCCTCCCAAGAATGTCAAATCATTGGGCACTCAATTGACTGAAGATTTCT
GCGGAGTGGAGCCAGTTACGCATCCGCCCATTGAAATCGAGACTAGGCCA
CCACCCTTGGTGGATGAGGAGAAGTTGCGCAAGGCATACAATGAAGTTGA
CTCTGTGCTGTTGGCATGTCTGCTTGTGATTCTCTTCCTGCTGCTGATCC
TTATGTTCTTCCTTATCGGTCGCTATTTGCACCGACACAAAGGCGACTAC
CTGACGCACGAGGATCAGGGTGCCGATGGAGCTGACGATCCAGACGATGC
TGTCCTGCACTCAACTACTGGCCATCAAGTCAGGAAGCGAACAGAGATCT
TTATCTAAACCGGTCGCAAGAATATGCACATAAATCGTTTTTAAATCGCC
TTAGGCACGCAACAGCGACCACTCAGACACACCAAAAGATAAAAAAAAAA
TAGATGAGAACGAAGTGAAAATCAAATAGACACGGAAAAGGCTCACCACG
CACAACAGACAGAAAATACTTTTCCATGCACTGCCAATTGTTTTGCGCAA
GTAAATGCTAAGATTTGATTTATAATTGGTTGGCTACATTTTGCACTTAT
GTTTTTTTTTTTAGTCTTTGGTTCTGTCTGACGGCATTATTGAAATTTCT
TCTATCACAGAATACCGTCCATTTTTAGTTAATTTTATGAACTTTTTGTT
TGCAAAATTGAGTTAAAAACTTATTTAAGGGAGCTGCCCGAGTAGCTCAA
CAAAAGCCACCTATTTTATGTATTTCTATTGCGCGAGTATGTAAGAACGA
ACATTCCATTATTTTTAATATGTTTTCTCGCTTTACGTTTAATTTAAAAA
TGTCTTCTACTTTACACACAAAAGAACATGAAAATCATTTTGTGGCTAAA
CAAAATCGGCTACTTTAGTAACACAAAGCATTAAAAACAAATTGTATTTT
TGGAAAATGCATTTTGAACGTCTTGACTTGAAATTTTCAAATATACATTA
GCATGTGTATATAGATATATATAGCAATAAAAAAATATATATAATTACAA
AAAAGAGACAATGAAAAAATTAAAATTTTTATCTTTCAATAAAAGAGAAC
TACAAATAAAAAAAAAAAAAAAAAAAAAAAAAAGAAAAAAAAAAAAAAAA

FI12817.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
Nrx-IV-RB 5109 Nrx-IV-RB 115..5024 1..4910 24535 99.9 Plus
Nrx-IV-RA 5109 Nrx-IV-RA 836..5024 722..4910 20930 99.9 Plus
Nrx-IV.b 4751 Nrx-IV.b 551..4738 723..4910 20925 99.9 Plus
Nrx-IV-RA 5109 Nrx-IV-RA 115..640 1..526 2630 100 Plus
Nrx-IV.b 4751 Nrx-IV.b 26..551 1..526 2630 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:10:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12143130..12144308 866..2044 5775 99.3 Plus
chr3L 24539361 chr3L 12144965..12145898 2371..3304 4640 99.8 Plus
chr3L 24539361 chr3L 12146806..12147744 3968..4910 4445 98.5 Plus
chr3L 24539361 chr3L 12137297..12137705 1..409 1910 97.8 Plus
chr3L 24539361 chr3L 12146196..12146545 3480..3829 1675 98.6 Plus
chr3L 24539361 chr3L 12144706..12144914 2171..2379 1030 99.5 Plus
chr3L 24539361 chr3L 12141960..12142157 526..723 990 100 Plus
chr3L 24539361 chr3L 12145957..12146139 3304..3486 915 100 Plus
chr3L 24539361 chr3L 12142925..12143068 722..865 705 99.3 Plus
chr3L 24539361 chr3L 12146610..12146749 3830..3969 700 100 Plus
chr3L 24539361 chr3L 12144378..12144503 2045..2170 615 99.2 Plus
chr3L 24539361 chr3L 12139547..12139666 407..526 600 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
Nrx-IV-RB 3855 CG6827-PB 1..3855 304..4158 19275 100 Plus
Nrx-IV-RA 3855 CG6827-PA 419..3855 722..4158 17185 100 Plus
Nrx-IV-RA 3855 CG6827-PA 1..223 304..526 1115 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:23:49 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
Nrx-IV-RB 4940 CG6827-RB 34..4940 1..4907 24520 100 Plus
Nrx-IV-RA 4940 CG6827-RA 755..4940 722..4907 20915 100 Plus
Nrx-IV-RA 4940 CG6827-RA 34..559 1..526 2630 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
Nrx-IV-PB 1284 CG6827-PB 1..1284 304..4155 6566 100 Plus
Nrx-IV-PA 1284 CG6827-PA 1..1284 304..4155 6312 96.4 Plus
axo-PI 2047 CG43225-PI 476..1311 856..3348 623 25 Plus
axo-PD 2070 CG43225-PD 476..1311 856..3348 623 25 Plus
axo-PH 2070 CG43225-PH 476..1311 856..3348 623 25 Plus
axo-PI 2047 CG43225-PI 1489..1800 3088..3939 196 22 Plus
axo-PD 2070 CG43225-PD 1489..1800 3088..3939 196 22 Plus
axo-PI 2047 CG43225-PI 220..676 2605..3876 179 23.5 Plus
axo-PD 2070 CG43225-PD 220..676 2605..3876 179 23.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12152380..12153558 866..2044 5895 100 Plus
3L 28110227 3L 12156051..12156993 3968..4910 4700 99.9 Plus
3L 28110227 3L 12154210..12155143 2371..3304 4655 99.9 Plus
3L 28110227 3L 12146552..12146960 1..409 2045 100 Plus
3L 28110227 3L 12155441..12155790 3480..3829 1735 99.7 Plus
3L 28110227 3L 12153951..12154159 2171..2379 1030 99.5 Plus
3L 28110227 3L 12151210..12151407 526..723 990 100 Plus
3L 28110227 3L 12155202..12155384 3304..3486 915 100 Plus
3L 28110227 3L 12152175..12152318 722..865 720 100 Plus
3L 28110227 3L 12155855..12155994 3830..3969 700 100 Plus
3L 28110227 3L 12153623..12153748 2045..2170 630 100 Plus
3L 28110227 3L 12148789..12148908 407..526 600 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12145480..12146658 866..2044 5895 100 Plus
3L 28103327 3L 12149151..12150093 3968..4910 4700 99.8 Plus
3L 28103327 3L 12147310..12148243 2371..3304 4655 99.8 Plus
3L 28103327 3L 12139652..12140060 1..409 2045 100 Plus
3L 28103327 3L 12148541..12148890 3480..3829 1735 99.7 Plus
3L 28103327 3L 12147051..12147259 2171..2379 1030 99.5 Plus
3L 28103327 3L 12144310..12144507 526..723 990 100 Plus
3L 28103327 3L 12148302..12148484 3304..3486 915 100 Plus
3L 28103327 3L 12145275..12145418 722..865 720 100 Plus
3L 28103327 3L 12148955..12149094 3830..3969 700 100 Plus
3L 28103327 3L 12146723..12146848 2045..2170 630 100 Plus
3L 28103327 3L 12141889..12142008 407..526 600 100 Plus
Blast to na_te.dros performed on 2014-11-27 05:10:40 has no hits.

FI12817.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:29:40 Download gff for FI12817.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12146806..12147735 3968..4901 96   Plus
chr3L 12146610..12146747 3830..3967 100 -> Plus
chr3L 12146201..12146545 3485..3829 98 -> Plus
chr3L 12145958..12146137 3305..3484 100 -> Plus
chr3L 12144969..12145898 2375..3304 99 -> Plus
chr3L 12144706..12144909 2171..2374 100 -> Plus
chr3L 12144378..12144503 2045..2170 99 -> Plus
chr3L 12143130..12144308 866..2044 99 -> Plus
chr3L 12142927..12143068 724..865 99 -> Plus
chr3L 12141961..12142157 527..723 100 -> Plus
chr3L 12139550..12139666 410..526 100 -> Plus
chr3L 12137297..12137705 1..409 97 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:21:05 Download gff for FI12817.complete
Subject Subject Range Query Range Percent Splice Strand
Nrx-IV-RB 1..3855 304..4158 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:26:13 Download gff for FI12817.complete
Subject Subject Range Query Range Percent Splice Strand
Nrx-IV-RB 1..3855 304..4158 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:35:57 Download gff for FI12817.complete
Subject Subject Range Query Range Percent Splice Strand
Nrx-IV-RB 1..3855 304..4158 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:29:40 Download gff for FI12817.complete
Subject Subject Range Query Range Percent Splice Strand
Nrx-IV-RB 1..3855 304..4158 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:21:04 Download gff for FI12817.complete
Subject Subject Range Query Range Percent Splice Strand
Nrx-IV-RB 1..4878 24..4901 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:26:13 Download gff for FI12817.complete
Subject Subject Range Query Range Percent Splice Strand
Nrx-IV-RB 1..4878 24..4901 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:35:57 Download gff for FI12817.complete
Subject Subject Range Query Range Percent Splice Strand
Nrx-IV-RB 34..4934 1..4901 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:29:40 Download gff for FI12817.complete
Subject Subject Range Query Range Percent Splice Strand
Nrx-IV-RB 34..4934 1..4901 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:29:40 Download gff for FI12817.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12156051..12156984 3968..4901 99   Plus
3L 12155855..12155992 3830..3967 100 -> Plus
3L 12155446..12155790 3485..3829 100 -> Plus
3L 12155203..12155382 3305..3484 100 -> Plus
3L 12154214..12155143 2375..3304 100 -> Plus
3L 12153951..12154154 2171..2374 100 -> Plus
3L 12153623..12153748 2045..2170 100 -> Plus
3L 12152380..12153558 866..2044 100 -> Plus
3L 12152177..12152318 724..865 100 -> Plus
3L 12151211..12151407 527..723 100 -> Plus
3L 12148792..12148908 410..526 100 -> Plus
3L 12146552..12146960 1..409 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:35:57 Download gff for FI12817.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12149151..12150084 3968..4901 99   Plus
arm_3L 12148955..12149092 3830..3967 100 -> Plus
arm_3L 12148546..12148890 3485..3829 100 -> Plus
arm_3L 12148303..12148482 3305..3484 100 -> Plus
arm_3L 12147314..12148243 2375..3304 100 -> Plus
arm_3L 12147051..12147254 2171..2374 100 -> Plus
arm_3L 12146723..12146848 2045..2170 100 -> Plus
arm_3L 12145480..12146658 866..2044 100 -> Plus
arm_3L 12145277..12145418 724..865 100 -> Plus
arm_3L 12144311..12144507 527..723 100 -> Plus
arm_3L 12141892..12142008 410..526 100 -> Plus
arm_3L 12139652..12140060 1..409 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:12:53 Download gff for FI12817.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12149151..12150084 3968..4901 99   Plus
3L 12148955..12149092 3830..3967 100 -> Plus
3L 12148546..12148890 3485..3829 100 -> Plus
3L 12148303..12148482 3305..3484 100 -> Plus
3L 12147314..12148243 2375..3304 100 -> Plus
3L 12147051..12147254 2171..2374 100 -> Plus
3L 12146723..12146848 2045..2170 100 -> Plus
3L 12145480..12146658 866..2044 100 -> Plus
3L 12145277..12145418 724..865 100 -> Plus
3L 12144311..12144507 527..723 100 -> Plus
3L 12141892..12142008 410..526 100 -> Plus
3L 12139652..12140060 1..409 100 -> Plus

FI12817.pep Sequence

Translation from 303 to 4157

> FI12817.pep
MRPPRSNTKAAFSSLQFGLLCLLLLVNNGIKSVQADAFTDYFSDYDCNQP
LMERAVLTATSSLTERGPDKARLNAGTSWSAKNSDFDQRLIIDLGVVRNV
THIALQGRPHSNEYVTEYTISYGITDLEFADYKEPGGNVKMFKGNSDGNS
IHYNVFEVPIIAQWVRINPTRWHDRISMRVELYGCDYISENLYFNGTGLV
RYDLRREPITSTKESIRFRFKTAFANGVMMYSRGTQGDYYALQLKDNKMV
LNLDLGSRVMTSLSVGSLLDDNVWHDVVISRNQRDIIFSVDRVIVRGRIQ
GEFTRLNLNRELYLGGVPNVQEGLIVQQNFSGCLENIYFNSTNFIRVMKD
STELGEGYLFTRVNTIYACPSPPIYPVTFTTRSSFVRLKGYENSQRLNVS
FYFRTYEETGVMLHHDFYSGGYLKVFLEFGKVKIDLKVKDKARIILDNYD
DQFNDGKWHSFVISIEKNRLILNIDQRPMTTTKSMQVATGAQYYIAGGKD
KNGFVGCMRLISVDGNYKLPQDWVKGEEVCCGDDVVVDACQMIDRCNPNP
CQHKGLCHQNSREFFCDCGHTGYAGAVCHTSNNPLSCLALKNVQHVQQRV
NLNLDVDGSGPLEPFPVTCEFYSDGRVITTLSHSQEHTTTVDGFQEPGSF
EQSIMYDANQLQIEALLNRSHSCWQRLSYSCRSSRLFNSPSEAGNFRPFS
WWISRHNQPMDYWAGALPGSRKCECGILGKCHDPTKWCNCDSNSLEWMED
GGDIREKEYLPVRAVKFGDTGTPLDEKMGRYTLGPLRCEGDDLFSNVVTF
RIADASINLPPFDMGHSGDIYLEFRTTQENSVIFHATGPTDYIKLSLNGG
NKLQFQYQAGSGPLGVNVGTSYHLNDNNWHTVSVERNRKEARLVVDGSIK
AEVREPPGPVRALHLTSDLVIGATTEYRDGYVGCIRALLLNGKMVDLKEY
SKRGLYGISTGCVGRCESNPCLNNGTCIERYDGYSCDCRWSAFKGPICAD
EIGVNLRSSSIIRYEFEGSFRSTIAENIRVGFTTTIPKGFLLGFSSNLTG
EYLTIQISNSGHLRCVFDFGFERQEIIFPKKHFGLGQYHDMHFMRKNGGS
TVVLKVDNYEPVEYNFDIKASADAQFNNIQYMYIGKNESMTDGFVGCVSR
VQFDDIYPLKLMFQQNPPKNVKSLGTQLTEDFCGVEPVTHPPIEIETRPP
PLVDEEKLRKAYNEVDSVLLACLLVILFLLLILMFFLIGRYLHRHKGDYL
THEDQGADGADDPDDAVLHSTTGHQVRKRTEIFI*

FI12817.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:42:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24804-PA 1360 GF24804-PA 151..1360 74..1284 5827 90.8 Plus
Dana\GF24721-PA 1778 GF24721-PA 484..1319 185..1015 644 25.8 Plus
Dana\GF24804-PA 1360 GF24804-PA 1..136 1..141 564 83.7 Plus
Dana\GF23380-PA 1840 GF23380-PA 372..808 194..596 348 27.6 Plus
Dana\GF23380-PA 1840 GF23380-PA 994..1319 796..1109 308 28.3 Plus
Dana\GF23380-PA 1840 GF23380-PA 571..907 798..1112 287 26.7 Plus
Dana\GF23380-PA 1840 GF23380-PA 787..1209 182..579 264 23.5 Plus
Dana\GF14840-PA 2343 GF14840-PA 2..378 208..571 223 22.8 Plus
Dana\GF10909-PA 3720 GF10909-PA 2879..3202 192..514 195 24.9 Plus
Dana\GF24721-PA 1778 GF24721-PA 1496..1732 929..1149 185 24.3 Plus
Dana\GF24721-PA 1778 GF24721-PA 230..684 770..1191 169 23 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:42:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15562-PA 1366 GG15562-PA 159..1366 77..1284 6098 95.5 Plus
Dere\GG15562-PA 1366 GG15562-PA 1..152 1..152 673 90.8 Plus
Dere\GG14167-PA 1782 GG14167-PA 476..1311 185..1015 651 25.7 Plus
Dere\GG11140-PA 1835 GG11140-PA 357..793 194..596 341 27.1 Plus
Dere\GG11140-PA 1835 GG11140-PA 979..1366 796..1167 313 26 Plus
Dere\GG11140-PA 1835 GG11140-PA 556..956 798..1179 296 25.4 Plus
Dere\GG11140-PA 1835 GG11140-PA 772..1194 182..579 263 23.5 Plus
Dere\GG21705-PA 3006 GG21705-PA 659..1042 196..571 216 22.7 Plus
Dere\GG14069-PA 3725 GG14069-PA 2879..3203 192..514 188 25.1 Plus
Dere\GG21705-PA 3006 GG21705-PA 659..856 803..995 177 29.7 Plus
Dere\GG14167-PA 1782 GG14167-PA 1489..1725 929..1149 173 23.1 Plus
Dere\GG14167-PA 1782 GG14167-PA 222..676 770..1191 173 23.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16153-PA 1351 GH16153-PA 134..1351 67..1284 5832 90.1 Plus
Dgri\GH15794-PA 1757 GH15794-PA 507..1342 185..1015 655 25.9 Plus
Dgri\GH16153-PA 1351 GH16153-PA 1..144 1..146 561 76.2 Plus
Dgri\GH22245-PA 1852 GH22245-PA 364..800 194..596 340 27.1 Plus
Dgri\GH22245-PA 1852 GH22245-PA 986..1378 796..1172 300 24.7 Plus
Dgri\GH22245-PA 1852 GH22245-PA 563..899 798..1112 293 26.5 Plus
Dgri\GH22245-PA 1852 GH22245-PA 779..1201 182..579 262 23.3 Plus
Dgri\GH10532-PA 2396 GH10532-PA 20..414 173..571 236 23.9 Plus
Dgri\GH23866-PA 1361 GH23866-PA 2..378 208..571 221 23.7 Plus
Dgri\GH15794-PA 1757 GH15794-PA 1375..1707 817..1107 181 22 Plus
Dgri\GH15794-PA 1757 GH15794-PA 253..707 770..1191 161 22.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
Nrx-IV-PB 1284 CG6827-PB 1..1284 1..1284 6890 100 Plus
Nrx-IV-PA 1284 CG6827-PA 1..1284 1..1284 6636 96.4 Plus
axo-PI 2047 CG43225-PI 476..1311 185..1015 651 25.2 Plus
axo-PD 2070 CG43225-PD 476..1311 185..1015 651 25.2 Plus
axo-PH 2070 CG43225-PH 476..1311 185..1015 651 25.2 Plus
axo-PI 2047 CG43225-PI 1489..1800 929..1212 196 22 Plus
axo-PD 2070 CG43225-PD 1489..1800 929..1212 196 22 Plus
axo-PI 2047 CG43225-PI 220..676 768..1191 179 23.5 Plus
axo-PD 2070 CG43225-PD 220..676 768..1191 179 23.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:42:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12425-PA 1279 GI12425-PA 16..1279 21..1284 6286 93.4 Plus
Dmoj\GI12577-PA 1738 GI12577-PA 488..1323 185..1015 650 26.1 Plus
Dmoj\GI21979-PA 1819 GI21979-PA 344..780 194..596 340 26.9 Plus
Dmoj\GI21979-PA 1819 GI21979-PA 966..1353 796..1167 297 25.5 Plus
Dmoj\GI21979-PA 1819 GI21979-PA 543..879 798..1112 293 26.7 Plus
Dmoj\GI21979-PA 1819 GI21979-PA 759..1181 182..579 270 23.7 Plus
Dmoj\GI17201-PA 2366 GI17201-PA 8..391 196..571 219 22.8 Plus
Dmoj\GI13231-PA 2725 GI13231-PA 1889..2214 192..515 196 24.3 Plus
Dmoj\GI12577-PA 1738 GI12577-PA 1356..1736 817..1149 182 22.1 Plus
Dmoj\GI12577-PA 1738 GI12577-PA 231..688 768..1191 168 22.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:42:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25157-PA 1355 GL25157-PA 148..1355 77..1284 5905 91.8 Plus
Dper\GL17936-PA 1738 GL17936-PA 486..1321 185..1015 644 25.7 Plus
Dper\GL25157-PA 1355 GL25157-PA 1..141 1..141 586 84.5 Plus
Dper\GL18745-PA 2404 GL18745-PA 37..427 177..571 230 23.7 Plus
Dper\GL21262-PA 3393 GL21262-PA 3052..3373 216..524 186 23 Plus
Dper\GL17936-PA 1738 GL17936-PA 1502..1735 929..1149 178 23.6 Plus
Dper\GL18548-PA 3402 GL18548-PA 1802..1919 70..188 175 31.1 Plus
Dper\GL17936-PA 1738 GL17936-PA 230..686 768..1191 174 22.2 Plus
Dper\GL18745-PA 2404 GL18745-PA 45..291 804..1047 170 27.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:42:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19887-PA 1355 GA19887-PA 148..1355 77..1284 5905 91.8 Plus
Dpse\GA14879-PA 1739 GA14879-PA 487..1322 185..1015 644 25.7 Plus
Dpse\GA19887-PA 1355 GA19887-PA 1..141 1..141 586 84.5 Plus
Dpse\GA20059-PB 1837 GA20059-PB 352..788 194..596 330 26.7 Plus
Dpse\GA20059-PB 1837 GA20059-PB 974..1361 796..1167 314 25.8 Plus
Dpse\GA20059-PB 1837 GA20059-PB 551..887 798..1112 294 26.7 Plus
Dpse\GA20059-PB 1837 GA20059-PB 773..1189 185..579 262 22.9 Plus
Dpse\GA10211-PA 2402 GA10211-PA 35..425 177..571 225 23.5 Plus
Dpse\GA13629-PA 3393 GA13629-PA 3052..3373 216..524 186 23 Plus
Dpse\GA14879-PA 1739 GA14879-PA 1503..1736 929..1149 178 23.6 Plus
Dpse\GA14879-PA 1739 GA14879-PA 231..687 768..1191 174 22.2 Plus
Dpse\GA10211-PA 2402 GA10211-PA 43..289 804..1047 170 27.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:42:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25331-PA 1561 GM25331-PA 324..1561 42..1284 6135 94 Plus
Dsec\GM13958-PA 1787 GM13958-PA 476..1311 185..1015 645 25.6 Plus
Dsec\GM25331-PA 1561 GM25331-PA 268..335 73..140 344 95.6 Plus
Dsec\GM26438-PA 1837 GM26438-PA 357..793 194..596 341 27.1 Plus
Dsec\GM25331-PA 1561 GM25331-PA 1..75 1..75 339 97.3 Plus
Dsec\GM26438-PA 1837 GM26438-PA 979..1366 796..1167 313 26 Plus
Dsec\GM26438-PA 1837 GM26438-PA 556..892 798..1112 294 26.7 Plus
Dsec\GM26438-PA 1837 GM26438-PA 772..1194 182..579 262 23.5 Plus
Dsec\GM17085-PA 2355 GM17085-PA 8..391 196..571 216 23.4 Plus
Dsec\GM13851-PA 3694 GM13851-PA 2862..3186 192..514 189 24.9 Plus
Dsec\GM17085-PA 2355 GM17085-PA 8..205 803..995 181 29.2 Plus
Dsec\GM13958-PA 1787 GM13958-PA 1489..1724 929..1149 176 23.2 Plus
Dsec\GM13958-PA 1787 GM13958-PA 222..676 770..1191 171 23.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14363-PA 1366 GD14363-PA 129..1366 42..1284 6127 94 Plus
Dsim\GD14363-PA 1366 GD14363-PA 1..140 1..140 690 100 Plus
Dsim\GD13240-PA 2498 GD13240-PA 476..1311 185..1015 647 25.6 Plus
Dsim\GD21830-PA 2174 GD21830-PA 12..395 196..571 212 22.7 Plus
Dsim\GD21830-PA 2174 GD21830-PA 12..259 803..1047 186 27.9 Plus
Dsim\GD13136-PA 3399 GD13136-PA 2607..2905 192..490 177 24.7 Plus
Dsim\GD13240-PA 2498 GD13240-PA 222..676 770..1191 173 23.3 Plus
Dsim\GD13136-PA 3399 GD13136-PA 3031..3321 186..474 173 22.8 Plus
Dsim\GD23957-PA 968 GD23957-PA 627..961 216..540 173 23.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:42:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12321-PA 1289 GJ12321-PA 82..1289 77..1284 5851 91.1 Plus
Dvir\GJ15482-PA 1730 GJ15482-PA 480..1315 185..1015 655 26.1 Plus
Dvir\GJ14339-PA 1797 GJ14339-PA 347..783 194..596 342 27.1 Plus
Dvir\GJ12321-PA 1289 GJ12321-PA 5..71 75..141 336 92.5 Plus
Dvir\GJ14339-PA 1797 GJ14339-PA 969..1356 796..1167 313 26.2 Plus
Dvir\GJ14339-PA 1797 GJ14339-PA 546..882 798..1112 293 26.5 Plus
Dvir\GJ14339-PA 1797 GJ14339-PA 762..1184 182..579 267 23.3 Plus
Dvir\GJ19831-PA 2393 GJ19831-PA 29..419 177..571 236 24.3 Plus
Dvir\GJ16642-PA 912 GJ16642-PA 229..632 822..1173 199 23.3 Plus
Dvir\GJ15482-PA 1730 GJ15482-PA 1348..1728 817..1149 174 21.6 Plus
Dvir\GJ15482-PA 1730 GJ15482-PA 226..680 770..1191 173 22.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25462-PA 1603 GK25462-PA 332..1603 75..1284 5955 89.2 Plus
Dwil\GK17598-PA 1790 GK17598-PA 522..1357 185..1015 648 25.8 Plus
Dwil\GK11702-PA 1867 GK11702-PA 375..811 194..596 343 27.3 Plus
Dwil\GK11702-PA 1867 GK11702-PA 997..1384 796..1167 315 26 Plus
Dwil\GK11702-PA 1867 GK11702-PA 574..910 798..1112 292 26.5 Plus
Dwil\GK11702-PA 1867 GK11702-PA 790..1212 182..579 263 23.3 Plus
Dwil\GK25462-PA 1603 GK25462-PA 21..77 19..75 206 66.7 Plus
Dwil\GK24915-PA 4180 GK24915-PA 3495..3901 822..1175 195 23.5 Plus
Dwil\GK17256-PA 3709 GK17256-PA 2872..3144 192..475 190 24.1 Plus
Dwil\GK17598-PA 1790 GK17598-PA 266..722 768..1191 174 23.2 Plus
Dwil\GK17598-PA 1790 GK17598-PA 1392..1770 819..1149 170 20.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21889-PA 1366 GE21889-PA 159..1366 77..1284 6102 95.6 Plus
Dyak\GE21889-PA 1366 GE21889-PA 1..170 1..173 687 83.8 Plus
Dyak\GE20595-PA 1766 GE20595-PA 476..1311 185..1015 647 25.7 Plus
Dyak\GE10306-PA 1835 GE10306-PA 357..793 194..596 342 27.1 Plus
Dyak\GE10306-PA 1835 GE10306-PA 979..1366 796..1167 314 26 Plus
Dyak\GE10306-PA 1835 GE10306-PA 556..892 798..1112 295 26.7 Plus
Dyak\GE10306-PA 1835 GE10306-PA 772..1194 182..579 263 23.5 Plus
Dyak\GE12728-PA 2355 GE12728-PA 15..391 208..571 221 24 Plus
Dyak\GE20494-PA 3710 GE20494-PA 2878..3202 192..514 190 24.9 Plus
Dyak\GE12728-PA 2355 GE12728-PA 8..205 803..995 184 29.7 Plus
Dyak\GE20595-PA 1766 GE20595-PA 1489..1725 929..1149 172 23.1 Plus
Dyak\GE20595-PA 1766 GE20595-PA 222..676 770..1191 171 23.3 Plus

FI12817.hyp Sequence

Translation from 303 to 4157

> FI12817.hyp
MRPPRSNTKAAFSSLQFGLLCLLLLVNNGIKSVQADAFTDYFSDYDCNQP
LMERAVLTATSSLTERGPDKARLNAGTSWSAKNSDFDQRLIIDLGVVRNV
THIALQGRPHSNEYVTEYTISYGITDLEFADYKEPGGNVKMFKGNSDGNS
IHYNVFEVPIIAQWVRINPTRWHDRISMRVELYGCDYISENLYFNGTGLV
RYDLRREPITSTKESIRFRFKTAFANGVMMYSRGTQGDYYALQLKDNKMV
LNLDLGSRVMTSLSVGSLLDDNVWHDVVISRNQRDIIFSVDRVIVRGRIQ
GEFTRLNLNRELYLGGVPNVQEGLIVQQNFSGCLENIYFNSTNFIRVMKD
STELGEGYLFTRVNTIYACPSPPIYPVTFTTRSSFVRLKGYENSQRLNVS
FYFRTYEETGVMLHHDFYSGGYLKVFLEFGKVKIDLKVKDKARIILDNYD
DQFNDGKWHSFVISIEKNRLILNIDQRPMTTTKSMQVATGAQYYIAGGKD
KNGFVGCMRLISVDGNYKLPQDWVKGEEVCCGDDVVVDACQMIDRCNPNP
CQHKGLCHQNSREFFCDCGHTGYAGAVCHTSNNPLSCLALKNVQHVQQRV
NLNLDVDGSGPLEPFPVTCEFYSDGRVITTLSHSQEHTTTVDGFQEPGSF
EQSIMYDANQLQIEALLNRSHSCWQRLSYSCRSSRLFNSPSEAGNFRPFS
WWISRHNQPMDYWAGALPGSRKCECGILGKCHDPTKWCNCDSNSLEWMED
GGDIREKEYLPVRAVKFGDTGTPLDEKMGRYTLGPLRCEGDDLFSNVVTF
RIADASINLPPFDMGHSGDIYLEFRTTQENSVIFHATGPTDYIKLSLNGG
NKLQFQYQAGSGPLGVNVGTSYHLNDNNWHTVSVERNRKEARLVVDGSIK
AEVREPPGPVRALHLTSDLVIGATTEYRDGYVGCIRALLLNGKMVDLKEY
SKRGLYGISTGCVGRCESNPCLNNGTCIERYDGYSCDCRWSAFKGPICAD
EIGVNLRSSSIIRYEFEGSFRSTIAENIRVGFTTTIPKGFLLGFSSNLTG
EYLTIQISNSGHLRCVFDFGFERQEIIFPKKHFGLGQYHDMHFMRKNGGS
TVVLKVDNYEPVEYNFDIKASADAQFNNIQYMYIGKNESMTDGFVGCVSR
VQFDDIYPLKLMFQQNPPKNVKSLGTQLTEDFCGVEPVTHPPIEIETRPP
PLVDEEKLRKAYNEVDSVLLACLLVILFLLLILMFFLIGRYLHRHKGDYL
THEDQGADGADDPDDAVLHSTTGHQVRKRTEIFI*

FI12817.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
Nrx-IV-PB 1284 CG6827-PB 1..1284 1..1284 6890 100 Plus
Nrx-IV-PA 1284 CG6827-PA 1..1284 1..1284 6636 96.4 Plus
axo-PI 2047 CG43225-PI 476..1311 185..1015 651 25.2 Plus
axo-PD 2070 CG43225-PD 476..1311 185..1015 651 25.2 Plus
axo-PH 2070 CG43225-PH 476..1311 185..1015 651 25.2 Plus
axo-PI 2047 CG43225-PI 1489..1800 929..1212 196 22 Plus
axo-PD 2070 CG43225-PD 1489..1800 929..1212 196 22 Plus
axo-PI 2047 CG43225-PI 220..676 768..1191 179 23.5 Plus
axo-PD 2070 CG43225-PD 220..676 768..1191 179 23.5 Plus