Clone FI12833 Report

Search the DGRC for FI12833

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:128
Well:33
Vector:pFlc-1
Associated Gene/TranscriptCG30403-RB
Protein status:FI12833.pep: gold
Sequenced Size:1724

Clone Sequence Records

FI12833.complete Sequence

1724 bp assembled on 2009-11-12

GenBank Submission: BT100286.1

> FI12833.complete
AGTTGTGGAGCAGCAGTTGCTCGAAGTGGTTATCGTTTGTGCTTTTTCCC
TTTGTGCTTTTTGGCACGAGGGACCATTGCCAAAGCGGGTTCTCTAAAAA
TAGAAAGCATTTCCAAAAACGATTATATTTTGAACGCGGCCATGAACAGT
GCCGTACCGCCCGGCGTGTTGGGACTACCCTATCGATTTTCGGATGAGCG
TACGGTCAAGTTCGTAGAGCTTTACGGCCGGGAACCTTGTCTCTGGAACA
AGCGACCATATTTGCGACGAGCTCGAAGCGCCGCCTATCGGCGAATTCAG
TCCGGGATCAATGCTGATATTGAACCATATGAGTCAGGTCTTACCATCCA
GGGCGTAAAGATGAAGATCAAGAATCTTCGTACTGGGTACCACCAGGAGC
TAAAGAAGATCCGAACTATTCCGGGATATCAGCCAAAGACGCCCTGGTTT
GCCCCACTTCACGGGTTTTTGGCAGAGTTCTTGGACACGAATGAGTTGGA
AACATCAATTCCTCAACTAAAGCGCCTACAGATTCGACTTACCAGACTGA
AGCCGATTAAGATTCAGACGGAGATTAAGCCAGATCCCGATGACTTGTCA
GTCCCCGATAGGCCGTTGGATGCTACACCCTCTTCCTTATTTACCGTTCT
GCCAGCACCTATGCCCGTGGAGGAGCCTCCCACTCCACCGCCTTCCGTGC
CCAAGATCGGAGACATCATCTCACCAGTACATCCAGACCCAGCGCCTGTT
CCGATAGCAGGGAACTGTCCTCTGTCGACAGCCTGCTCCATTTCTGAAAA
AAGTGAGGTCTTGGGATTGGGCCTGGGAGTATCGGCAGCTGGACGGACGA
ATGGAGTTGGCCTTGGAGTTGAAATGCGAGGCGAGGACGAATTCACCTAC
TTCGGGTTGAGCGTTGCAGCGCAAATCCGTAATATGCCATTGGCCAGTGC
CATGCTAATGCAGTCGAAAATCCAGTATATGCTCTCTATGGAGCGTCGTA
AGATTAACGGTCATCCTGGCGATATGGACATATTTCTAACTAAAAACTAA
GTTTCTTTTGAAAATGGTGGAGATTACATTCCTTTAAATGAATCTGTGAA
TATGGTTATACGTTATCTGCTTGTATAATTTGGCAGAAAATCTTCATTGT
ACAATTAACCATGCTTATGTGCTGTGTGTTCTTGTTTAAAAACACTCTTG
AAGTATCATATTGGATTAAAATCAACGACAAAGCAACCTCATGTTATATA
TAAGTTATATAATTTATGATAAGTGGAAGAAAAATATATTTTTGTTCATA
CCAAATCGAAAAATTCGAATTTAAATTTATGTAAATTAAACCTTTGCTGT
ACGGCTGATGCGCCTAGGAACAGAAAAAATAAAACTACAAAATATGCAAA
AATAATGTAAATTAGATAATTTATAATTTACCATTCATGGTAACATATCA
TTGCTGGATTATCTAGTGGCTTCGATTTGCGAGCGTTCACTGTGCCGCCG
GAAGAAAAGCAGAAAAGCAAGACGGCAAAAACATTGCGAGTGGGAGAAAA
CAAAACTGTACAGTACAGCGAACCAGCAAATAGAGGCACTCTCTTCGACC
GACTGAGTGTGTTGGTGAGCTGTGTAAAATACACGCGAGTAAAGTGCGTG
TAAAATGTGACATAATGTAATGCGTAATGTATATTTCAATTAAATCTATA
ATCAGTTGCAAAAAAAAAAAAAAA

FI12833.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG30403.a 2127 CG30403.a 419..2127 1..1709 8545 100 Plus
CG30403-RB 1823 CG30403-RB 115..1823 1..1709 8545 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 13:25:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17595928..17597150 1709..489 5885 98.9 Minus
chr2R 21145070 chr2R 17597607..17598095 489..1 2370 99 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:25:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG30403-RB 909 CG30403-PB 1..909 142..1050 4545 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:23:51 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG30403-RB 1268 CG30403-RB 5..1268 1..1264 6320 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG30403-PB 302 CG30403-PB 1..302 142..1047 1371 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:25:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21709447..21710670 1712..489 6120 100 Minus
2R 25286936 2R 21711121..21711609 489..1 2445 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21710646..21711869 1712..489 6120 100 Minus
2R 25260384 2R 21712320..21712808 489..1 2445 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:25:31 has no hits.

FI12833.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 15:53:26 Download gff for FI12833.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17597607..17598095 1..489 98   Minus
chr2R 17595928..17597149 490..1709 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-12 11:45:13 Download gff for FI12833.complete
Subject Subject Range Query Range Percent Splice Strand
CG30403-RB 1..909 142..1050 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:24:02 Download gff for FI12833.complete
Subject Subject Range Query Range Percent Splice Strand
CG30403-RB 1..909 142..1050 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:14:03 Download gff for FI12833.complete
Subject Subject Range Query Range Percent Splice Strand
CG30403-RB 1..909 142..1050 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:53:26 Download gff for FI12833.complete
Subject Subject Range Query Range Percent Splice Strand
CG30403-RB 1..909 142..1050 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-12 11:45:12 Download gff for FI12833.complete
Subject Subject Range Query Range Percent Splice Strand
CG30403-RB 1..1709 1..1709 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:24:02 Download gff for FI12833.complete
Subject Subject Range Query Range Percent Splice Strand
CG30403-RB 1..1709 1..1709 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:14:03 Download gff for FI12833.complete
Subject Subject Range Query Range Percent Splice Strand
CG30403-RB 5..1268 1..1264 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:53:26 Download gff for FI12833.complete
Subject Subject Range Query Range Percent Splice Strand
CG30403-RB 5..1268 1..1264 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:53:26 Download gff for FI12833.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21711121..21711609 1..489 100   Minus
2R 21709450..21710669 490..1709 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:14:03 Download gff for FI12833.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17598626..17599114 1..489 100   Minus
arm_2R 17596955..17598174 490..1709 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:11:21 Download gff for FI12833.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21712320..21712808 1..489 100   Minus
2R 21710649..21711868 490..1709 100 <- Minus

FI12833.pep Sequence

Translation from 0 to 1049

> FI12833.pep
SCGAAVARSGYRLCFFPLCFLARGTIAKAGSLKIESISKNDYILNAAMNS
AVPPGVLGLPYRFSDERTVKFVELYGREPCLWNKRPYLRRARSAAYRRIQ
SGINADIEPYESGLTIQGVKMKIKNLRTGYHQELKKIRTIPGYQPKTPWF
APLHGFLAEFLDTNELETSIPQLKRLQIRLTRLKPIKIQTEIKPDPDDLS
VPDRPLDATPSSLFTVLPAPMPVEEPPTPPPSVPKIGDIISPVHPDPAPV
PIAGNCPLSTACSISEKSEVLGLGLGVSAAGRTNGVGLGVEMRGEDEFTY
FGLSVAAQIRNMPLASAMLMQSKIQYMLSMERRKINGHPGDMDIFLTKN*

FI12833.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:12:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11621-PA 288 GF11621-PA 9..287 59..345 877 60.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20747-PA 299 GG20747-PA 1..299 48..347 1231 88 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:12:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20783-PA 272 GH20783-PA 8..272 59..346 608 45.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG30403-PB 302 CG30403-PB 1..302 48..349 1581 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:12:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20866-PA 268 GI20866-PA 6..267 58..345 669 49.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:12:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17522-PA 260 GL17522-PA 1..259 48..345 806 58 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:12:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24190-PA 260 GA24190-PA 1..259 48..345 793 56 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:12:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15691-PA 300 GM15691-PA 1..300 48..347 1301 94.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25170-PA 300 GD25170-PA 1..300 48..347 1301 94.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:12:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20602-PA 275 GJ20602-PA 7..274 58..345 673 49.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:12:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15657-PA 285 GK15657-PA 19..161 61..201 386 52.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:12:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13679-PA 297 GE13679-PA 1..297 48..345 1258 87.6 Plus

FI12833.hyp Sequence

Translation from 0 to 1049

> FI12833.hyp
SCGAAVARSGYRLCFFPLCFLARGTIAKAGSLKIESISKNDYILNAAMNS
AVPPGVLGLPYRFSDERTVKFVELYGREPCLWNKRPYLRRARSAAYRRIQ
SGINADIEPYESGLTIQGVKMKIKNLRTGYHQELKKIRTIPGYQPKTPWF
APLHGFLAEFLDTNELETSIPQLKRLQIRLTRLKPIKIQTEIKPDPDDLS
VPDRPLDATPSSLFTVLPAPMPVEEPPTPPPSVPKIGDIISPVHPDPAPV
PIAGNCPLSTACSISEKSEVLGLGLGVSAAGRTNGVGLGVEMRGEDEFTY
FGLSVAAQIRNMPLASAMLMQSKIQYMLSMERRKINGHPGDMDIFLTKN*

FI12833.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG30403-PB 302 CG30403-PB 1..302 48..349 1581 100 Plus