Clone FI12865 Report

Search the DGRC for FI12865

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:128
Well:65
Vector:pFlc-1
Associated Gene/TranscriptCG9510-RB
Protein status:FI12865.pep: gold
Sequenced Size:1596

Clone Sequence Records

FI12865.complete Sequence

1596 bp assembled on 2009-11-12

GenBank Submission: BT100288.1

> FI12865.complete
AGTAGTCAAACAACTGTTACGCCAATCGGATCCATCATGACCCAGATCCC
CGAGAGCTGTTATAAGATGTGGGGTGGTAGGTTCACCGAGGGGCCGCATG
AGGCTCTCCATTCGCTGAATAACAGCCTGCCCTACGATTCTCGCCTCTAT
GCGGATGATTTGGACGCCAGCAAGGCGTATGCAGAGGCACTCCATCGAGC
TGGTCTCATCAACTCAGCCGAGGCGGATAAGTTGGTAAAGAATCTGGAGC
TGTTGCGATTCGATTGGATCGAGGGAACTGTGAAGATTCTACCCGGTGAC
GAGGATGTGCACACGGTGAACGAGCGATTGCTGGTGGAGATTACCGGCGA
ACTGGGCCAGCGGCTTCACACGGGCAGAAGCAGAAATGACCAGGTGGTCA
CGGACATGAAGCTATGGCTTCGCAAGGCCATTCGTGAGACCTTGGGCCGG
CTGAGTGGCATCATTGAAACTGCCACCAGGCAGGCGGAACTCCACCTGGG
CGTCCTCATGCCAGGATACACGCATCTGCAGCGGGCCCAGACCGTTCAGT
TCTCCCACTGGCTGCTCTCGCACGCGTTTGCATTAAGGGAAGATGGCCAG
CGGCTGTTGGAGCTAAGGGATCGGGCGAATGTCCTGCCCCTTGGAAGTGG
CGCTCTGGCGGGAAATCCCCTTGGCATCGATCGTTTGTGGCTGGCCGAGA
GGCTGGGATTCTCGGGTGTCACAGCCAACAGCATGCACGCCGTGGGAGAT
CGAGATTTTGTAGTTGACTTCATCTACTGCTGCTCTATGGTGAGCCTGCA
TCTGTCCCGATTGGCGGAGGATTTGATCATCTACAGTACCAAGGAGTTCG
ACTTCATCAAACTGGCCGATGGCTTTTCCAGTGGCAGCAGCCTGATGCCT
CAGAAAAGGAATCCGGACAGCTTGGAGCTGATTCGCGGCATGGCCGGTGT
GATCACCGCCAATCTGACGGGCATAATGATGACCATTAAGGGCACTCCGT
CCACCTACAACAAGGACTTGCAGTACGACAAGCAATTCTGCTTCCAGTCC
TTCGACAAGCTGTCCCAAGTGCTCGAGGTTACCGATGGTGTCCTACAGAC
GATTCAGGTCAAGCAGGAATCAATGGAGGCGGCACTTAGCACAGACATGC
TGGCCACTGACTGGGCCTACTATCTGGTGAAGAAGGGGGTTCCATTCCGC
CAGGCGCATCACATTATCGGTCGCGTGGTCTCGGAGGCCGAAAAGCGCGG
TGTGGACATCACTGATTTGCCGCTGGGAGATCTCCAGAAATTCAGTCCTT
TATTTGGATCGGATATCGTTGCAGTGGCGGACTACTCCAACAATGTCCAG
CAATATAATGCGATTGGTGGAACCGCCAGTAGCAGCATCGTGGAACAACT
GCGTTTGCTCAAGAAGTGCGCAAGGGATTTGGCCAAACAGTCGTAGGTTC
CTATGACTATTTCTGTGGTAATTCTTGGCTATATTGAATCGCATTGTTTT
ACTTATCAAAAATATATGTTATATGTTAGTAAAGAAGACCATACTTCTGA
CTGAAATCAATATAACTTCTGCAACGGAACAAAAAAAAAAAAAAAA

FI12865.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG9510-RC 2839 CG9510-RC 1221..2799 1..1579 7895 100 Plus
CG9515-RA 2839 CG9515-RA 1221..2799 1..1579 7895 100 Plus
CG9510-RB 1729 CG9510-RB 111..1689 1..1579 7895 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8939911..8940677 767..1 3805 99.7 Minus
chr2L 23010047 chr2L 8938700..8939115 1579..1164 2080 100 Minus
chr2L 23010047 chr2L 8939171..8939575 1165..761 2025 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG9510-RD 1410 CG9510-PD 1..1410 37..1446 7050 100 Plus
CG9510-RC 1410 CG9510-PC 1..1410 37..1446 7050 100 Plus
CG9510-RB 1410 CG9510-PB 1..1410 37..1446 7050 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:23:55 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG9510-RD 1640 CG9510-RD 4..1582 1..1579 7895 100 Plus
CG9510-RC 1922 CG9510-RC 346..1922 1..1577 7885 100 Plus
CG9510-RB 1580 CG9510-RB 4..1580 1..1577 7885 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG9510-PD 469 CG9510-PD 1..469 37..1443 2404 100 Plus
CG9510-PC 469 CG9510-PC 1..469 37..1443 2404 100 Plus
CG9510-PB 469 CG9510-PB 1..469 37..1443 2404 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8940994..8941760 767..1 3820 99.9 Minus
2L 23513712 2L 8939783..8940198 1579..1164 2080 100 Minus
2L 23513712 2L 8940254..8940658 1165..761 2025 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:42:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8940994..8941760 767..1 3820 99.8 Minus
2L 23513712 2L 8939783..8940198 1579..1164 2080 100 Minus
2L 23513712 2L 8940254..8940658 1165..761 2025 100 Minus
Blast to na_te.dros performed on 2014-11-27 10:01:42 has no hits.

FI12865.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:55:36 Download gff for FI12865.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8939915..8940677 1..763 99   Minus
chr2L 8939172..8939572 764..1164 100 <- Minus
chr2L 8938699..8939114 1165..1580 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-12 11:45:10 Download gff for FI12865.complete
Subject Subject Range Query Range Percent Splice Strand
CG9510-RC 1..1410 37..1446 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:24:06 Download gff for FI12865.complete
Subject Subject Range Query Range Percent Splice Strand
CG9510-RC 1..1410 37..1446 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:07:31 Download gff for FI12865.complete
Subject Subject Range Query Range Percent Splice Strand
CG9510-RB 1..1410 37..1446 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:55:36 Download gff for FI12865.complete
Subject Subject Range Query Range Percent Splice Strand
CG9510-RB 1..1410 37..1446 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-12 11:45:10 Download gff for FI12865.complete
Subject Subject Range Query Range Percent Splice Strand
CG9515-RA 1221..2799 1..1580 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:24:06 Download gff for FI12865.complete
Subject Subject Range Query Range Percent Splice Strand
CG9515-RA 1221..2799 1..1580 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:07:31 Download gff for FI12865.complete
Subject Subject Range Query Range Percent Splice Strand
CG9510-RD 4..1582 1..1580 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:55:36 Download gff for FI12865.complete
Subject Subject Range Query Range Percent Splice Strand
CG9510-RD 4..1582 1..1580 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:55:36 Download gff for FI12865.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8940998..8941760 1..763 100   Minus
2L 8940255..8940655 764..1164 100 <- Minus
2L 8939782..8940197 1165..1580 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:07:31 Download gff for FI12865.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8940998..8941760 1..763 100   Minus
arm_2L 8940255..8940655 764..1164 100 <- Minus
arm_2L 8939782..8940197 1165..1580 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:11:24 Download gff for FI12865.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8940998..8941760 1..763 100   Minus
2L 8940255..8940655 764..1164 100 <- Minus
2L 8939782..8940197 1165..1580 99 <- Minus

FI12865.pep Sequence

Translation from 0 to 1445

> FI12865.pep
SSQTTVTPIGSIMTQIPESCYKMWGGRFTEGPHEALHSLNNSLPYDSRLY
ADDLDASKAYAEALHRAGLINSAEADKLVKNLELLRFDWIEGTVKILPGD
EDVHTVNERLLVEITGELGQRLHTGRSRNDQVVTDMKLWLRKAIRETLGR
LSGIIETATRQAELHLGVLMPGYTHLQRAQTVQFSHWLLSHAFALREDGQ
RLLELRDRANVLPLGSGALAGNPLGIDRLWLAERLGFSGVTANSMHAVGD
RDFVVDFIYCCSMVSLHLSRLAEDLIIYSTKEFDFIKLADGFSSGSSLMP
QKRNPDSLELIRGMAGVITANLTGIMMTIKGTPSTYNKDLQYDKQFCFQS
FDKLSQVLEVTDGVLQTIQVKQESMEAALSTDMLATDWAYYLVKKGVPFR
QAHHIIGRVVSEAEKRGVDITDLPLGDLQKFSPLFGSDIVAVADYSNNVQ
QYNAIGGTASSSIVEQLRLLKKCARDLAKQS*

FI12865.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14347-PA 475 GF14347-PA 2..475 2..481 2179 83.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24049-PA 469 GG24049-PA 1..469 13..481 2348 93.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13007-PA 471 GH13007-PA 9..471 19..481 1980 77.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:12:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG9510-PD 469 CG9510-PD 1..469 13..481 2404 100 Plus
CG9510-PC 469 CG9510-PC 1..469 13..481 2404 100 Plus
CG9510-PB 469 CG9510-PB 1..469 13..481 2404 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12353-PA 476 GI12353-PA 1..476 13..481 2009 77.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26211-PA 468 GL26211-PA 5..468 18..481 2085 81.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:12:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17268-PA 468 GA17268-PA 5..468 18..481 2088 81.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12672-PA 469 GM12672-PA 1..469 13..481 2472 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22377-PA 346 GD22377-PA 1..346 136..481 1806 98 Plus
Dsim\GD11959-PA 137 GD11959-PA 1..108 170..276 448 80.6 Plus
Dsim\GD22378-PA 105 GD22378-PA 14..86 1..80 356 85 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17877-PA 474 GJ17877-PA 1..474 13..481 1995 77 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:12:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10731-PA 469 GE10731-PA 1..469 13..481 2415 95.7 Plus

FI12865.hyp Sequence

Translation from 0 to 1445

> FI12865.hyp
SSQTTVTPIGSIMTQIPESCYKMWGGRFTEGPHEALHSLNNSLPYDSRLY
ADDLDASKAYAEALHRAGLINSAEADKLVKNLELLRFDWIEGTVKILPGD
EDVHTVNERLLVEITGELGQRLHTGRSRNDQVVTDMKLWLRKAIRETLGR
LSGIIETATRQAELHLGVLMPGYTHLQRAQTVQFSHWLLSHAFALREDGQ
RLLELRDRANVLPLGSGALAGNPLGIDRLWLAERLGFSGVTANSMHAVGD
RDFVVDFIYCCSMVSLHLSRLAEDLIIYSTKEFDFIKLADGFSSGSSLMP
QKRNPDSLELIRGMAGVITANLTGIMMTIKGTPSTYNKDLQYDKQFCFQS
FDKLSQVLEVTDGVLQTIQVKQESMEAALSTDMLATDWAYYLVKKGVPFR
QAHHIIGRVVSEAEKRGVDITDLPLGDLQKFSPLFGSDIVAVADYSNNVQ
QYNAIGGTASSSIVEQLRLLKKCARDLAKQS*

FI12865.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG9510-PD 469 CG9510-PD 1..469 13..481 2404 100 Plus
CG9510-PC 469 CG9510-PC 1..469 13..481 2404 100 Plus
CG9510-PB 469 CG9510-PB 1..469 13..481 2404 100 Plus