Clone FI12926 Report

Search the DGRC for FI12926

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:129
Well:26
Vector:pFlc-1
Associated Gene/TranscriptEb1-RF
Protein status:FI12926.pep: gold
Sequenced Size:1875

Clone Sequence Records

FI12926.complete Sequence

1875 bp assembled on 2009-11-12

GenBank Submission: BT100289.1

> FI12926.complete
GATCAGTGTACATTTTACATCCCTAGCGCTCGCTCGTTTAGCAGAAGACG
GTTTTTCATAGAATTAACATTTCCTTGTTTAAAGCCAGGAATCATTTAGT
TCTCCGTCGCCCCGAAGGATAACGACCAACTGATTAGTGCCGCTAACTAA
ACCAGAGGACACCACCAACATGGCTGTAAACGTCTACTCCACAAATGTGA
CGTCAGAGAATCTCTCGCGCCACGATATGCTAGCTTGGGTTAACGATTGC
CTCCAGTCGCAATTCTCAAAAATCGAGGAGCTCTGCACAGGTGCAGCTTA
CTGTCAGTTCATGGACATGCTGTTTCCCAATTCAGTGCCAGTAAAGCGTG
TCAAATTTCGTACCAATCTGGAGCACGAGTACATACAGAACTTCAAGATA
TTGCAGGCGGGCTTCAAGAAGATGTCTGTGGATAAGATCATTCCAGTTGA
TAAACTGATTAAGGGACGCTTTCAAGACAACTTTGAGTTCCTTCAATGGT
TTAAAAAATTCTTCGACGCCAATTACGACGGTCGCGAGTACGACCCCGTG
GCTCAGCGGGGCGGAGTCAAGCTGGGCAATGGCAACGGACACGGCAGCAA
CGGAGGCAGTGGCGTGGGCAGCAGCAACAACGATCTCCATCTGATGCACC
GGCGACCATTGCAGGCTCCAGCTTCTGGCGGACGAATGCCAGCACGGGTC
ATCGCTTCAACTGCAGTATCCAAGGTGCTGCCGCGCACGAACAACGCAGC
CCCAGCGAGCAGAATAAACGCCTGTGCCAACAGCACGGGCACGGTCAAGA
AGAACGACGTGAGCAATTCGGTCAACAATCAACAAATAGAAGAGATGTCA
AATCAGGTGATGGATATGCGCATAAACCTGGAGGGATTGGAAAAGGAGCG
AGACTTTTACTTCTCTAAGTTGCGGGATATTGAAATTCTTTGCCAAGAAG
CCGATGACGCCGAGGCGCATCCGATCATACAAAAGATTTTGGACATCTTA
TATGCGACTGAGGATGGTTTTGCGCCGCCTGACGATGCACCACCAGAGGA
CGAGGAGTATTAATTTGAAACGTGAACGAAAACCCACTAAATTCATTTGC
TGCATACATATTCAAAACATAAGTCAAGAAGCATGATGAAGGGGACAGAG
TTTATTATTTAGACAGAATCCAAGAAGACGTTAAGCAAAAACGAGAAGAC
TAACAAATGAAGAGTGTTTGATTTCCTAGGCCGAGGCTGACAGCAGGATC
GCCACGTGATTAAATAGTTATTCTTCAAACATTTATTTGATACGAACGCG
TCGTCGCTTAACAGATAGAGACGGGATTTTTTTCGATTCAAAATTGTACC
CACGATAATTTTGCTGATGTTGCCGATGTGTGTGAACCATCAACCATTTC
ATATTTAAATTGTTTGTATATTAGCGGAATAAACGAACCAAATCTCGATA
TCTAATGGAAAGCCAGCCTACCCTTTTCAAAATTCTTTTTTGAAAGGTTC
ACAGACTCGTAACTAAGAAAATTTAGAATGCTCAGCTTGCAAATTTACTT
TGATTTAGATTAGCTCTTTGTATCACATGGTTTACATGGTTGATTTATAT
CCTATTAAGCACATTTATAATTTTTGTTTAAGTAAAACTTTTCACTAGCT
GACTTTTGTCGTTTTGAGTGTTGTATGTAGTGGATCACAAGAGCCGAACC
AACGGTATTTTGTACTTTCGATTTCTATTTTTAAATAATTGGCTTCATAA
CAAAATGATTGTATAAAATAAGTGATTTTTGCTCTCAATTTTTTAAGTTC
TATATTTATGTGTAAAACAGGCAGAACTCGTTAAAAAGTTTGAATAAAAG
CGAACGTCTAAAAAAAAAAAAAAAA

FI12926.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
Eb1-RF 2046 Eb1-RF 72..1932 2..1862 9305 100 Plus
Eb1.e 1923 Eb1.e 63..1920 2..1862 9235 99.8 Plus
Eb1.d 1929 Eb1.d 778..1926 714..1862 5745 100 Plus
Eb1.d 1929 Eb1.d 218..610 136..528 1695 95.4 Plus
Eb1.d 1929 Eb1.d 63..198 2..137 680 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2642404..2643251 1011..1858 4240 100 Plus
chr2R 21145070 chr2R 2640443..2640721 435..713 1365 99.3 Plus
chr3LHet 2555433 chr3LHet 687420..687887 75..528 1220 85.7 Plus
chr3LHet 2555433 chr3LHet 688326..688559 1052..1285 1095 97.9 Plus
chr3LHet 2555433 chr3LHet 688055..688325 714..986 1090 94.1 Plus
chr3LHet 2555433 chr3LHet 688559..688746 1319..1506 835 96.3 Plus
chr2R 21145070 chr2R 2639848..2640004 136..292 785 100 Plus
chr2R 21145070 chr2R 2641922..2642068 713..859 735 100 Plus
chr2R 21145070 chr2R 2640059..2640206 289..436 725 99.3 Plus
chr2R 21145070 chr2R 2636462..2636597 2..137 650 98.5 Plus
chr2R 21145070 chr2R 2642115..2642202 852..939 440 100 Plus
chr2R 21145070 chr2R 2642266..2642339 940..1013 370 100 Plus
chr3LHet 2555433 chr3LHet 688756..688819 1682..1745 290 96.9 Plus
chr3L 24539361 chr3L 7759965..7760242 550..273 250 72.7 Minus
chr2R 21145070 chr2R 2641422..2641489 461..528 205 86.8 Plus
chr2R 21145070 chr2R 14739475..14739538 517..454 200 87.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Eb1-RF 894 CG3265-PF 1..894 170..1063 4470 100 Plus
Eb1-RG 876 CG3265-PG 527..876 714..1063 1750 100 Plus
Eb1-RA 876 CG3265-PA 527..876 714..1063 1750 100 Plus
Eb1-RG 876 CG3265-PG 1..359 170..528 1525 95 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:23:57 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Eb1-RF 1891 CG3265-RF 28..1885 2..1859 9290 100 Plus
Eb1-RG 2043 CG3265-RG 629..1774 714..1859 5730 100 Plus
Eb1-RA 1873 CG3265-RA 722..1867 714..1859 5730 100 Plus
Eb1-RG 2043 CG3265-RG 71..461 138..528 1685 95.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Eb1-PF 297 CG3265-PF 1..280 170..1009 1234 100 Plus
Eb1-PE 290 CG3265-PE 1..273 170..1009 1053 82.9 Plus
Eb1-PG 291 CG3265-PG 1..274 170..1009 1049 81.4 Plus
Eb1-PA 291 CG3265-PA 1..274 170..1009 1049 81.4 Plus
Eb1-PD 291 CG3265-PD 1..274 170..1009 1049 81.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6755183..6756034 1011..1862 4260 100 Plus
2R 25286936 2R 6753225..6753503 435..713 1395 100 Plus
3L 28110227 3L 25201942..25202409 75..528 1220 85.7 Plus
3L 28110227 3L 25202848..25203081 1052..1285 1095 97.9 Plus
3L 28110227 3L 25202577..25202847 714..986 1090 94.1 Plus
3L 28110227 3L 25203081..25203268 1319..1506 835 96.3 Plus
2R 25286936 2R 6752630..6752786 136..292 785 100 Plus
2R 25286936 2R 6752841..6752988 289..436 740 100 Plus
2R 25286936 2R 6754701..6754847 713..859 735 100 Plus
2R 25286936 2R 6749254..6749389 2..137 680 100 Plus
2R 25286936 2R 6754894..6754981 852..939 440 100 Plus
2R 25286936 2R 6755045..6755118 940..1013 370 100 Plus
3L 28110227 3L 25203278..25203341 1682..1745 290 96.9 Plus
3L 28110227 3L 7767870..7768147 550..273 250 72.7 Minus
2R 25286936 2R 6754204..6754271 461..528 205 86.8 Plus
2R 25286936 2R 18852347..18852410 517..454 185 85.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:42:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6756382..6757233 1011..1862 4260 100 Plus
2R 25260384 2R 6754424..6754702 435..713 1395 100 Plus
3L 28103327 3L 25195677..25195947 714..986 1100 94.1 Plus
3L 28103327 3L 25195948..25196181 1052..1285 1095 97.8 Plus
3L 28103327 3L 25196181..25196368 1319..1506 835 96.2 Plus
2R 25260384 2R 6753829..6753985 136..292 785 100 Plus
2R 25260384 2R 6754040..6754187 289..436 740 100 Plus
2R 25260384 2R 6755900..6756046 713..859 735 100 Plus
2R 25260384 2R 6750453..6750588 2..137 680 100 Plus
3L 28103327 3L 25195138..25195306 149..317 680 93.4 Plus
3L 28103327 3L 25195311..25195509 330..528 680 89.4 Plus
2R 25260384 2R 6756093..6756180 852..939 440 100 Plus
2R 25260384 2R 6756244..6756317 940..1013 370 100 Plus
3L 28103327 3L 25196378..25196441 1682..1745 290 96.8 Plus
3L 28103327 3L 25195042..25195104 75..137 270 95.2 Plus
2R 25260384 2R 6755403..6755470 461..528 205 86.7 Plus
Blast to na_te.dros performed on 2014-11-26 20:07:05 has no hits.

FI12926.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:21:48 Download gff for FI12926.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2642406..2643251 1013..1859 99   Plus
chr2R 2642266..2642338 940..1012 100 -> Plus
chr2R 2642120..2642202 857..939 100 -> Plus
chr2R 2641923..2642065 714..856 100 -> Plus
chr2R 2640445..2640721 437..713 99 -> Plus
chr2R 2640061..2640206 291..436 99 -> Plus
chr2R 2639850..2640002 138..290 100 -> Plus
chr2R 2636460..2636597 1..137 97 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-12 11:45:09 Download gff for FI12926.complete
Subject Subject Range Query Range Percent Splice Strand
Eb1-RF 1..894 170..1063 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:24:09 Download gff for FI12926.complete
Subject Subject Range Query Range Percent Splice Strand
Eb1-RF 1..894 170..1063 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:57:17 Download gff for FI12926.complete
Subject Subject Range Query Range Percent Splice Strand
Eb1-RF 1..894 170..1063 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:21:48 Download gff for FI12926.complete
Subject Subject Range Query Range Percent Splice Strand
Eb1-RF 1..894 170..1063 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-12 11:45:09 Download gff for FI12926.complete
Subject Subject Range Query Range Percent Splice Strand
Eb1-RF 61..1920 1..1859 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:24:09 Download gff for FI12926.complete
Subject Subject Range Query Range Percent Splice Strand
Eb1-RF 61..1920 1..1859 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:57:17 Download gff for FI12926.complete
Subject Subject Range Query Range Percent Splice Strand
Eb1-RF 26..1885 1..1859 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:21:48 Download gff for FI12926.complete
Subject Subject Range Query Range Percent Splice Strand
Eb1-RF 26..1885 1..1859 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:21:48 Download gff for FI12926.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6755185..6756031 1013..1859 100   Plus
2R 6755045..6755117 940..1012 100 -> Plus
2R 6754899..6754981 857..939 100 -> Plus
2R 6754702..6754844 714..856 100 -> Plus
2R 6753227..6753503 437..713 100 -> Plus
2R 6752843..6752988 291..436 100 -> Plus
2R 6752632..6752784 138..290 100 -> Plus
2R 6749252..6749389 1..137 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:57:17 Download gff for FI12926.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2642690..2643536 1013..1859 100   Plus
arm_2R 2642550..2642622 940..1012 100 -> Plus
arm_2R 2642404..2642486 857..939 100 -> Plus
arm_2R 2642207..2642349 714..856 100 -> Plus
arm_2R 2640732..2641008 437..713 100 -> Plus
arm_2R 2640348..2640493 291..436 100 -> Plus
arm_2R 2640137..2640289 138..290 100 -> Plus
arm_2R 2636757..2636894 1..137 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:11:27 Download gff for FI12926.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6756384..6757230 1013..1859 100   Plus
2R 6756244..6756316 940..1012 100 -> Plus
2R 6756098..6756180 857..939 100 -> Plus
2R 6755901..6756043 714..856 100 -> Plus
2R 6754426..6754702 437..713 100 -> Plus
2R 6754042..6754187 291..436 100 -> Plus
2R 6753831..6753983 138..290 100 -> Plus
2R 6750451..6750588 1..137 99 -> Plus

FI12926.pep Sequence

Translation from 169 to 1062

> FI12926.pep
MAVNVYSTNVTSENLSRHDMLAWVNDCLQSQFSKIEELCTGAAYCQFMDM
LFPNSVPVKRVKFRTNLEHEYIQNFKILQAGFKKMSVDKIIPVDKLIKGR
FQDNFEFLQWFKKFFDANYDGREYDPVAQRGGVKLGNGNGHGSNGGSGVG
SSNNDLHLMHRRPLQAPASGGRMPARVIASTAVSKVLPRTNNAAPASRIN
ACANSTGTVKKNDVSNSVNNQQIEEMSNQVMDMRINLEGLEKERDFYFSK
LRDIEILCQEADDAEAHPIIQKILDILYATEDGFAPPDDAPPEDEEY*

FI12926.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11070-PA 434 GF11070-PA 16..233 1..218 790 78.8 Plus
Dana\GF11070-PA 434 GF11070-PA 233..434 90..297 749 71.7 Plus
Dana\GF23323-PA 338 GF23323-PA 8..253 2..277 673 50.5 Plus
Dana\GF13745-PA 240 GF13745-PA 4..126 1..123 444 60.2 Plus
Dana\GF20898-PA 335 GF20898-PA 6..118 8..114 165 32.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:12:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23222-PA 393 GG23222-PA 1..190 1..190 862 94.2 Plus
Dere\GG23222-PA 393 GG23222-PA 192..393 90..297 783 75.9 Plus
Dere\GG20937-PA 248 GG20937-PA 4..126 1..123 437 58.5 Plus
Dere\GG18930-PA 625 GG18930-PA 6..158 2..151 304 41.8 Plus
Dere\GG24985-PA 907 GG24985-PA 3..117 4..119 228 37.1 Plus
Dere\GG18890-PA 209 GG18890-PA 23..135 23..130 184 35.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:12:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21755-PA 377 GH21755-PA 1..160 1..162 834 93.8 Plus
Dgri\GH21755-PA 377 GH21755-PA 180..377 94..297 648 65.1 Plus
Dgri\GH19731-PA 243 GH19731-PA 7..129 1..123 390 54.5 Plus
Dgri\GH11211-PA 145 GH11211-PA 5..122 2..119 364 54.2 Plus
Dgri\GH12721-PA 149 GH12721-PA 7..144 1..136 315 42.8 Plus
Dgri\GH12671-PA 56 GH12671-PA 5..56 4..56 161 58.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:12:46
Subject Length Description Subject Range Query Range Score Percent Strand
Eb1-PF 297 CG3265-PF 1..297 1..297 1560 100 Plus
Eb1-PE 290 CG3265-PE 1..290 1..297 1269 84.4 Plus
Eb1-PG 291 CG3265-PG 1..291 1..297 1265 83.7 Plus
Eb1-PA 291 CG3265-PA 1..291 1..297 1265 83.7 Plus
Eb1-PD 291 CG3265-PD 1..291 1..297 1265 83.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:12:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19301-PA 423 GI19301-PA 1..163 1..164 794 89.6 Plus
Dmoj\GI19301-PA 423 GI19301-PA 220..423 90..297 662 63.9 Plus
Dmoj\GI16249-PA 266 GI16249-PA 1..236 1..277 599 46.6 Plus
Dmoj\GI20155-PA 236 GI20155-PA 1..130 15..134 376 50.8 Plus
Dmoj\GI14128-PA 207 GI14128-PA 8..137 3..130 340 46.2 Plus
Dmoj\GI15398-PA 493 GI15398-PA 12..152 5..145 340 44.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:12:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11119-PA 414 GL11119-PA 1..171 1..167 840 88.9 Plus
Dper\GL11119-PA 414 GL11119-PA 212..414 89..297 656 62.4 Plus
Dper\GL10583-PA 257 GL10583-PA 4..229 1..283 408 33.8 Plus
Dper\GL24349-PA 199 GL24349-PA 2..124 3..123 251 38.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17043-PA 381 GA17043-PA 1..381 1..297 1148 60.9 Plus
Dpse\GA14834-PA 257 GA14834-PA 4..229 1..283 408 33.8 Plus
Dpse\GA25462-PA 218 GA25462-PA 6..156 3..159 260 32.3 Plus
Dpse\GA26582-PA 229 GA26582-PA 2..124 3..123 257 39 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20898-PA 393 GM20898-PA 1..190 1..190 881 95.8 Plus
Dsec\GM20898-PA 393 GM20898-PA 192..393 90..297 805 75.9 Plus
Dsec\GM19864-PA 246 GM19864-PA 6..126 3..123 436 59.5 Plus
Dsec\GM13642-PA 418 GM13642-PA 27..151 15..141 232 38.6 Plus
Dsec\GM11276-PA 183 GM11276-PA 18..149 23..149 209 34.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10423-PA 393 GD10423-PA 1..190 1..190 881 95.8 Plus
Dsim\GD10423-PA 393 GD10423-PA 192..393 90..297 805 75.9 Plus
Dsim\GD25351-PA 248 GD25351-PA 4..126 1..123 438 58.5 Plus
Dsim\GD22515-PA 415 GD22515-PA 27..162 15..152 234 37 Plus
Dsim\GD23272-PA 367 GD23272-PA 14..117 16..119 214 38.5 Plus
Dsim\GD24542-PA 183 GD24542-PA 18..149 23..149 199 33.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:12:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22178-PA 384 GJ22178-PA 1..160 1..163 826 92.6 Plus
Dvir\GJ22178-PA 384 GJ22178-PA 183..384 90..297 660 64.9 Plus
Dvir\GJ16714-PA 257 GJ16714-PA 15..235 23..286 488 41.2 Plus
Dvir\GJ22432-PA 236 GJ22432-PA 8..126 5..123 386 54.6 Plus
Dvir\GJ17762-PA 191 GJ17762-PA 6..189 2..174 357 39.8 Plus
Dvir\GJ14795-PA 431 GJ14795-PA 16..155 2..140 339 42.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:12:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22141-PA 373 GK22141-PA 1..164 1..164 808 94.5 Plus
Dwil\GK18120-PA 260 GK18120-PA 1..259 1..295 764 51.7 Plus
Dwil\GK22141-PA 373 GK22141-PA 168..373 90..297 710 68.6 Plus
Dwil\GK12829-PA 267 GK12829-PA 1..262 1..287 707 49.5 Plus
Dwil\GK20694-PA 252 GK20694-PA 4..220 1..278 423 34.4 Plus
Dwil\GK24903-PA 479 GK24903-PA 1..186 1..180 296 36.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:13:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19075-PA 385 GE19075-PA 1..183 1..183 859 97.3 Plus
Dyak\GE19075-PA 385 GE19075-PA 180..385 86..297 792 75 Plus
Dyak\GE13874-PA 249 GE13874-PA 4..126 1..123 440 59.3 Plus
Dyak\GE15400-PA 495 GE15400-PA 11..162 1..149 334 43.4 Plus
Dyak\GE18379-PA 435 GE18379-PA 25..146 13..136 236 36.3 Plus
Dyak\GE18273-PA 546 GE18273-PA 3..117 4..119 234 37.1 Plus

FI12926.hyp Sequence

Translation from 169 to 1062

> FI12926.hyp
MAVNVYSTNVTSENLSRHDMLAWVNDCLQSQFSKIEELCTGAAYCQFMDM
LFPNSVPVKRVKFRTNLEHEYIQNFKILQAGFKKMSVDKIIPVDKLIKGR
FQDNFEFLQWFKKFFDANYDGREYDPVAQRGGVKLGNGNGHGSNGGSGVG
SSNNDLHLMHRRPLQAPASGGRMPARVIASTAVSKVLPRTNNAAPASRIN
ACANSTGTVKKNDVSNSVNNQQIEEMSNQVMDMRINLEGLEKERDFYFSK
LRDIEILCQEADDAEAHPIIQKILDILYATEDGFAPPDDAPPEDEEY*

FI12926.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:54:32
Subject Length Description Subject Range Query Range Score Percent Strand
Eb1-PF 297 CG3265-PF 1..297 1..297 1560 100 Plus
Eb1-PE 290 CG3265-PE 1..290 1..297 1269 84.4 Plus
Eb1-PG 291 CG3265-PG 1..291 1..297 1265 83.7 Plus
Eb1-PA 291 CG3265-PA 1..291 1..297 1265 83.7 Plus
Eb1-PD 291 CG3265-PD 1..291 1..297 1265 83.7 Plus