Clone FI12929 Report

Search the DGRC for FI12929

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:129
Well:29
Vector:pFlc-1
Associated Gene/TranscriptTsp5D-RA
Protein status:FI12929.pep: gold
Sequenced Size:1989

Clone Sequence Records

FI12929.complete Sequence

1989 bp assembled on 2009-11-13

GenBank Submission: BT120367.1

> FI12929.complete
GAGTCAGTTTATTTTGAACAACCGCGGCGAGCGCATAGAACACGCCAAAC
GAACCGAAAATCTGATATCCCAAGCCAGCGATCCGAGTATCCGAATCAGA
ATCAGAATCAGAATCAAAATCAGAAGTGCAGAACCAAACGAAACGTTTGG
GAACGCGAATCGGAGATTCCTGCGCCAGTGAATTGTTTATTTTCCTATTC
TTTTTTTTTTCGAGTTAAATTCCGTGGCTTATAGTGCGAATCGAAGTCCG
TTGGAAACAGTGCTAAATCGTCTTGAAGCCAATATCCCGCGATGGGCAAT
GCCGGCTACACTTGCATACGCCGCACATTCTGCTGGCTCAACATCATTCT
ATGGTTATGTAGCTGTGCGTTTTTAGGAGCGGGACTCTGGTTGCGACTGA
GCTACGCGGGATACGCCACTTTGCTGCCCCAGCACGCAGGTCTGAGTGCG
GACACCATCTTCATGGGCATCGGGGGCACCGGATTTGTGGTCAGCTTCTT
TGGCTGCTGCGGCGCCTGGGTGCAATCCCGCTGTCTCCTGGTATTGTACT
TTATGCTGATTGTAATGCTGTTCATGAGCGAGTTCCTGGTTGGCTCCATC
GCCTTTCTCTTCCGCGGCGGACTGGGACGGACTTTGGCCAACGAGCTGCG
CTTCGGGATCGAGCGGCATTATAACAGCAGCGATCGGGGATCTCTGGTGG
CGCCTTCGGTGGCCTCCATTTGGGACAGCGTGCAGCAGTCGTTCGAGTGT
TGCGGCGTTTCCTCCTACGAGGATTGGTATGACATTCAGTCGTGGCCAGG
CAGGCGCTGGGTGCCAGAGTCCTGCTGCAGGACCCTCTACGACCAGCGCC
AGGTGCTCACCGAAGGATCCGGCGACGGAATGATGCGTCCCGACTGCGGC
AGATCTGAGAATCCGTCGCTGTGGTGGGACAAGGGCTGTGCCCACTCGCT
GCAGAGCTGGTTCACCGGCCAGCTGAACGTGGTGGGCGCCGTGGGACTGG
GCATCGCCTTTGTCCAGCTGTTCGGGCTGATCACCTCGATGCTGCTGTTC
TGCACGGTGAAGCACAAGCGGGCCTCGGACACCTACAAGTCATACTCCCC
GTCGATTGATCCTCAGACCCGCACCAGCAGTTGGGAAGATTGAACGCGCC
TGTGACGGTGGTAGGCGGACTTCTAAATTGGGGGGTTGCAGTCGGCCTCC
CGAACTCCCTGTCGCTATCTCTATTCCTTTTGTTAACTCTCTTAGTTTCT
AATTTATTCTGCGAAATGTGCCAAAAATTAATTTAATTCAAAGTGTATTT
TTTTTTGTTTTTTTGTTTGTAATCTGTAGGCGGAGACAAGTCGAAACAAA
ATTGAACTGGCAGCAAAATGACAAATTCGCACTGGGCACAGTGTGAACAT
GTCATATTGCTGCCGGTGAAACAATCACATATTTAGTTAGCAGTGTATCC
ATATTGTGATGTGCTCTCTAGTAGTATAGTATAAGGCCCAAGGCCCGAAA
CGCACCTGGAACAGGGTATAGTGCGTTCCATACTTATCAGGCTGGCTGCT
TAGCTGCAAGAGTACCTGACACATATATACAGCTAGTGTGAGTCGGAATC
CTTGGACCTGGATATGCTTATGCTCGTAACCCTTCAACTAAACCAATATA
TCAACTACAATATATATTTATATATAATTATATAATACTTATGTTACTTT
ATGGAAATCTGTAGTATTCGAAATAGCAGAAACCGCAACTGCCCGAAAAG
CGCGAGGAAAGCGAGAAGAGAAGAGAAAAGAAAAGAAGAGAAGACGAAGT
GGAGAAAGAGGGAGCAAATAGTTAAAGCAAATATTACATTACTACTATGC
GTATGATTATTTTATTCATACATACAAATATTTATATCGAAATGCATTCC
TAAACAACATGTTCGTGTTAAGTTACAAAATAAATTAAAGTATTTATTTA
AATTACACGCCTTCTCAAAGGCCCAAAAAAAAAAAAAAA

FI12929.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:45:21
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp5D-RA 1986 Tsp5D-RA 10..1982 3..1975 9865 100 Plus
Tsp5D-RB 1832 Tsp5D-RB 134..1828 281..1975 8475 100 Plus
CG5928-RB 861 CG5928-RB 730..861 1975..1844 660 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 5961370..5962442 1974..901 5245 99.4 Minus
chrX 22417052 chrX 5966820..5967094 283..3 1280 97.9 Minus
chrX 22417052 chrX 5962759..5962954 741..546 965 99.5 Minus
chrX 22417052 chrX 5963096..5963288 546..354 950 99.5 Minus
chrX 22417052 chrX 5962531..5962692 902..741 810 100 Minus
chrX 22417052 chrX 5964044..5964114 354..284 355 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:24:10
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp5D-RC 864 CG4690-PC 1..864 292..1155 4320 100 Plus
Tsp5D-RB 852 CG4690-PB 1..852 292..1143 4260 100 Plus
Tsp5D-RA 852 CG4690-PA 1..852 292..1143 4260 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:23:59 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:24:09
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp5D-RA 1972 CG4690-RA 1..1972 3..1974 9860 100 Plus
Tsp5D-RC 1827 CG4690-RC 134..1827 281..1974 8470 100 Plus
Tsp5D-RB 1827 CG4690-RB 134..1827 281..1974 8470 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp5D-PC 287 CG4690-PC 1..287 292..1152 1559 99.7 Plus
Tsp5D-PB 283 CG4690-PB 1..283 292..1140 1549 100 Plus
Tsp5D-PA 283 CG4690-PA 1..283 292..1140 1549 100 Plus
Tsp74F-PB 236 CG5492-PB 71..232 487..1050 235 26.6 Plus
Tsp74F-PA 236 CG5492-PA 71..232 487..1050 235 26.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6069130..6070204 1975..901 5375 100 Minus
X 23542271 X 6074577..6074857 283..3 1405 100 Minus
X 23542271 X 6070521..6070716 741..546 980 100 Minus
X 23542271 X 6070857..6071049 546..354 965 100 Minus
X 23542271 X 6070293..6070454 902..741 810 100 Minus
X 23542271 X 6071805..6071875 354..284 355 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6077228..6078302 1975..901 5375 100 Minus
X 23527363 X 6082675..6082955 283..3 1405 100 Minus
X 23527363 X 6078619..6078814 741..546 980 100 Minus
X 23527363 X 6078955..6079147 546..354 965 100 Minus
X 23527363 X 6078391..6078552 902..741 810 100 Minus
X 23527363 X 6079903..6079973 354..284 355 100 Minus
Blast to na_te.dros performed 2014-11-27 03:24:08
Subject Length Description Subject Range Query Range Score Percent Strand
Tc3 1743 Tc3 TC3 1743bp 1611..1662 1836..1889 121 72.2 Plus
transib2 2844 transib2 TRANSIB2 2844bp 2534..2573 125..86 119 77.5 Minus

FI12929.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:53:16 Download gff for FI12929.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 5964044..5964114 284..354 100 <- Minus
chrX 5963096..5963287 355..546 99 <- Minus
chrX 5962759..5962953 547..741 99 <- Minus
chrX 5962531..5962691 742..902 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-13 15:49:09 Download gff for FI12929.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp5D-RB 1..852 292..1143 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:24:30 Download gff for FI12929.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp5D-RB 1..852 292..1143 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:11:46 Download gff for FI12929.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp5D-RC 1..864 292..1155 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:53:16 Download gff for FI12929.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp5D-RC 1..864 292..1155 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-13 15:49:08 Download gff for FI12929.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp5D-RA 1..1972 3..1974 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:24:30 Download gff for FI12929.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp5D-RA 1..1972 3..1974 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:11:46 Download gff for FI12929.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp5D-RA 1..1972 3..1974 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:53:16 Download gff for FI12929.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp5D-RA 1..1972 3..1974 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:53:16 Download gff for FI12929.complete
Subject Subject Range Query Range Percent Splice Strand
X 6074577..6074857 1..283 99   Minus
X 6071805..6071875 284..354 100 <- Minus
X 6070857..6071048 355..546 100 <- Minus
X 6070521..6070715 547..741 100 <- Minus
X 6070293..6070453 742..902 100 <- Minus
X 6069131..6070202 903..1974 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:11:46 Download gff for FI12929.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5968610..5968890 1..283 99   Minus
arm_X 5965838..5965908 284..354 100 <- Minus
arm_X 5964890..5965081 355..546 100 <- Minus
arm_X 5964554..5964748 547..741 100 <- Minus
arm_X 5964326..5964486 742..902 100 <- Minus
arm_X 5963164..5964235 903..1974 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:11:40 Download gff for FI12929.complete
Subject Subject Range Query Range Percent Splice Strand
X 6082675..6082955 1..283 99   Minus
X 6079903..6079973 284..354 100 <- Minus
X 6078955..6079146 355..546 100 <- Minus
X 6078619..6078813 547..741 100 <- Minus
X 6078391..6078551 742..902 100 <- Minus
X 6077229..6078300 903..1974 100 <- Minus

FI12929.pep Sequence

Translation from 291 to 1142

> FI12929.pep
MGNAGYTCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAG
LSADTIFMGIGGTGFVVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLV
GSIAFLFRGGLGRTLANELRFGIERHYNSSDRGSLVAPSVASIWDSVQQS
FECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMMRP
DCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSM
LLFCTVKHKRASDTYKSYSPSIDPQTRTSSWED*

FI12929.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20316-PA 283 GF20316-PA 1..283 1..283 1450 96.1 Plus
Dana\GF25226-PA 236 GF25226-PA 71..236 66..257 223 26.3 Plus
Dana\GF15553-PA 248 GF15553-PA 11..229 9..247 222 26.4 Plus
Dana\GF12397-PA 239 GF12397-PA 1..239 1..262 202 24.8 Plus
Dana\GF24363-PA 267 GF24363-PA 4..231 3..227 198 27 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:14:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17700-PA 283 GG17700-PA 1..283 1..283 1487 99.6 Plus
Dere\GG15769-PA 236 GG15769-PA 71..236 66..257 222 26.3 Plus
Dere\GG25314-PA 248 GG25314-PA 11..229 9..247 215 24.9 Plus
Dere\GG22652-PA 239 GG22652-PA 1..239 1..262 211 25.6 Plus
Dere\GG14356-PA 267 GG14356-PA 4..231 3..227 191 25 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:14:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24112-PA 284 GH24112-PA 1..284 1..283 1415 94 Plus
Dgri\GH20509-PA 240 GH20509-PA 1..240 1..263 244 25.9 Plus
Dgri\GH14575-PA 236 GH14575-PA 71..236 66..257 226 26.8 Plus
Dgri\GH15333-PA 267 GH15333-PA 4..257 3..257 209 24.4 Plus
Dgri\GH13315-PA 235 GH13315-PA 1..225 1..253 207 23.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp5D-PB 283 CG4690-PB 1..283 1..283 1549 100 Plus
Tsp5D-PA 283 CG4690-PA 1..283 1..283 1549 100 Plus
Tsp5D-PC 287 CG4690-PC 1..283 1..283 1549 100 Plus
Tsp74F-PB 236 CG5492-PB 71..232 66..253 235 26.6 Plus
Tsp74F-PA 236 CG5492-PA 71..232 66..253 235 26.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:14:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16371-PA 285 GI16371-PA 1..285 1..283 1405 93.3 Plus
Dmoj\GI21055-PA 240 GI21055-PA 50..240 51..263 242 28.2 Plus
Dmoj\GI13972-PA 236 GI13972-PA 71..236 66..257 230 26.8 Plus
Dmoj\GI17425-PA 248 GI17425-PA 11..229 9..247 197 23.8 Plus
Dmoj\GI12231-PA 235 GI12231-PA 1..225 1..253 195 22.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:14:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14958-PA 283 GL14958-PA 1..283 1..283 1441 95.8 Plus
Dper\GL10398-PA 239 GL10398-PA 1..239 1..262 226 24 Plus
Dper\GL22737-PA 236 GL22737-PA 71..236 66..257 224 26.3 Plus
Dper\GL25578-PA 248 GL25578-PA 11..229 9..247 195 25.9 Plus
Dper\GL26662-PA 235 GL26662-PA 1..225 1..253 190 22.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:15:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22293-PA 283 GA22293-PA 1..283 1..283 1442 96.1 Plus
Dpse\GA21493-PA 239 GA21493-PA 1..239 1..262 225 23.7 Plus
Dpse\GA18924-PA 236 GA18924-PA 71..236 66..257 224 26.3 Plus
Dpse\GA22650-PA 303 GA22650-PA 77..270 51..244 197 29.2 Plus
Dpse\GA21830-PA 248 GA21830-PA 11..229 9..247 194 25.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:15:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12598-PA 282 GM12598-PA 21..282 22..283 1382 100 Plus
Dsec\GM24293-PA 236 GM24293-PA 71..236 66..257 223 26.3 Plus
Dsec\GM17261-PA 248 GM17261-PA 11..229 9..247 215 25.8 Plus
Dsec\GM20434-PA 225 GM20434-PA 36..225 51..262 209 27.8 Plus
Dsec\GM25100-PA 267 GM25100-PA 4..255 3..252 209 25.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:15:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16218-PA 282 GD16218-PA 21..282 22..283 1382 100 Plus
Dsim\GD23574-PA 1578 GD23574-PA 1370..1559 38..247 224 28.6 Plus
Dsim\GD12362-PA 236 GD12362-PA 71..236 66..257 223 26.3 Plus
Dsim\GD14136-PA 267 GD14136-PA 4..255 3..252 210 25.3 Plus
Dsim\GD25905-PA 246 GD25905-PA 57..246 51..262 209 27.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16743-PA 283 GJ16743-PA 1..283 1..283 1408 92.9 Plus
Dvir\GJ21977-PA 240 GJ21977-PA 1..240 1..263 236 26.2 Plus
Dvir\GJ14111-PA 236 GJ14111-PA 71..236 66..257 224 26.3 Plus
Dvir\GJ13079-PA 267 GJ13079-PA 4..257 3..257 203 24.8 Plus
Dvir\GJ18360-PA 248 GJ18360-PA 11..229 9..247 198 24.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17445-PA 283 GK17445-PA 1..283 1..283 1429 94.7 Plus
Dwil\GK21888-PA 239 GK21888-PA 1..238 1..261 240 26.1 Plus
Dwil\GK20576-PA 236 GK20576-PA 71..236 66..257 224 26.3 Plus
Dwil\GK13989-PA 288 GK13989-PA 30..272 7..244 213 29.4 Plus
Dwil\GK24538-PA 248 GK24538-PA 11..229 9..247 206 25.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16487-PA 295 GE16487-PA 13..295 1..283 1491 99.6 Plus
Dyak\GE22102-PA 236 GE22102-PA 71..236 66..257 223 26.3 Plus
Dyak\GE13526-PA 239 GE13526-PA 1..239 1..262 210 25.2 Plus
Dyak\GE18806-PA 248 GE18806-PA 11..229 9..247 209 25.8 Plus
Dyak\Tsp66E-PA 267 GE20788-PA 4..255 3..252 205 25.3 Plus

FI12929.hyp Sequence

Translation from 291 to 1142

> FI12929.hyp
MGNAGYTCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAG
LSADTIFMGIGGTGFVVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLV
GSIAFLFRGGLGRTLANELRFGIERHYNSSDRGSLVAPSVASIWDSVQQS
FECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMMRP
DCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSM
LLFCTVKHKRASDTYKSYSPSIDPQTRTSSWED*

FI12929.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp5D-PB 283 CG4690-PB 1..283 1..283 1549 100 Plus
Tsp5D-PA 283 CG4690-PA 1..283 1..283 1549 100 Plus
Tsp5D-PC 287 CG4690-PC 1..283 1..283 1549 100 Plus
Tsp74F-PB 236 CG5492-PB 71..232 66..253 235 26.6 Plus
Tsp74F-PA 236 CG5492-PA 71..232 66..253 235 26.6 Plus