Clone FI13109 Report

Search the DGRC for FI13109

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:131
Well:9
Vector:pOT2
Associated Gene/TranscriptDNApol-epsilon58-RA
Protein status:FI13109.pep: gold
Sequenced Size:1658

Clone Sequence Records

FI13109.complete Sequence

1658 bp assembled on 2009-12-14

GenBank Submission: BT120029.1

> FI13109.complete
TAATAACAATGGATGTGGATTTACTGCCGCTGAGAAAGCGAATAACGAAC
ACTTTCAAGTTATGTGGATTCCTGATCCGCTCGGAGAACAGTTCCTACCT
GGCGGAGCAGCTGCTGCCCTTCGACGCAGCGGAACGGGACAAATGGCTGA
CGGTGATCACCGAGAATCTCCAAAGCCAAAAGCTTTTGACGCCTCATGTG
GAGCGAGCCGCCCTGGAGAAGGCTATCAATGAACTTAACCGGGTGGGATT
GGATGAAGGGGAGACGGTCTTTGCCCTGATCGATGCCTTTACGGTGCCCC
GTTTTCGGTACAACCAGCGGATAAAGAAATTCGAACTGGACACACAGCCG
CGCCAGTTGCTGACCGCTCCGCGCATGAAATCGGACTACATGCAGCAACG
ATATGCCATGTTACTACAGAAAACTCTGCGACACGACCTCTTTGCCCCAG
CCGTCATCCAGGATGGCGTTGGAGCCGAGGCCCAGGCCAAGAAATTTAAG
CTCCAGTTCGCTGAGAACCTGCTGGCCACGTCGGCGATGAAGGAGGCAGT
TGTTTTGGGACTACTTACCCAGCTTAAGGAGGGCAAGTTCTATGTCGAGG
ATCCCACGGGTTGCGTCCAGTTAGATCTCACTGGAGCCCGTTTCCATGCC
GGCTTCTTCTGCGAGGGCTGCTTTGTTTTAGCCGAGGGCAACTATAACAA
CGGTGTGCTCAAGGTTGATGGCCTGGGCTTTCCACCCGCGGAACCGGCAA
ACAGCAGTCGAGCATTTTTCGGCACCGCCAACACTTGGGGCGGTGAATCT
GCTAAGCTGCTGAAGTACTCAGCCGGACTACAGGAACTGGAGCGTACCAA
CACGGAAACAACCATTGTTTTCCTTTCCGACGTACGGTTGGATCTGCCGG
TTGTCATGGAGAAGCTGCGCCAGTTGTTCGTGGGCTATGATTCCTGCCCG
CCGCAAGCTATAGTGCTCATGGGCCCCTTCACGGCCAGCACAAGGAATCA
TCATGAGCTGAGGCATCACCTAGATGCATTGGGTGGCTTGGCAGCTGGCT
GCGAGCAGCTGAAGAAGCAAACGGATCTGATACTTGTTCCCTCGTCTGAA
GATCCCACGGCACCTAATATTCTGCCTCGTGCTCCAATTCCCGAATGCCT
GGCAGCCGGGCTGCTAAAGGCCTGGCCACGCACCCAGTTGGCTACGAATC
CGTGTCGCCTACAGTACTGCACCCAGCAGATTGTGGTCTGCCGTCTGGAT
TTAATGGCCAAGTTTTGTCGCAACACCTTGCATTTTCCCGAAGATACGTC
CCAGATCGAGCAGCATTTTGCCAGAACGATTGTGTGCCAGGGTCATTTGG
TGCCCATTCATCCGATTGCCATGCCAGTGCACTGGGACTACGATCCTGCT
TTGTGGTTGTATCCACTGCCGGATCTTATTGTCATGGGCGATTCGTGCCA
GAGCTTTAGCAGCAGTCAACATGGCTGCACTGTTCTCAATACCGGCTCCT
TTGTCAAGTCCAAGTTCGCATTCAAAGTGTATATACCAGCGACGCGAACG
ATTGAGGACTCGGAAATACCGGACGAATTGGAGTAGTTATGATATAGTTA
ACCTTAACGTAAGTTTGAATAATTATTTAATTACATATGTAAAAAAAAAA
AAAAAAAA

FI13109.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
Pole2-RA 1760 Pole2-RA 47..1686 1..1640 7720 98 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5888258..5889184 1640..714 4440 98.6 Minus
chr3L 24539361 chr3L 5889241..5889954 714..1 3570 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
DNApol-epsilon58-RA 1578 CG10489-PA 1..1578 9..1586 7410 98 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:24:16 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
DNApol-epsilon58-RA 1688 CG10489-RA 49..1688 1..1640 7720 98 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
DNApol-epsilon58-PA 525 CG10489-PA 1..525 9..1583 2751 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5895691..5896617 1640..714 4365 98.1 Minus
3L 28110227 3L 5896674..5897387 714..1 3360 98 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:44:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5888791..5889717 1640..714 4365 98 Minus
3L 28103327 3L 5889774..5890487 714..1 3360 98 Minus
Blast to na_te.dros performed on 2014-11-27 05:11:52 has no hits.

FI13109.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:30:00 Download gff for FI13109.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5889241..5889954 1..714 100   Minus
chr3L 5888258..5889183 715..1640 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-14 11:37:26 Download gff for FI13109.complete
Subject Subject Range Query Range Percent Splice Strand
Pole2-RA 1..1578 9..1586 97   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:28:08 Download gff for FI13109.complete
Subject Subject Range Query Range Percent Splice Strand
Pole2-RA 1..1578 9..1586 97   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:36:08 Download gff for FI13109.complete
Subject Subject Range Query Range Percent Splice Strand
Pole2-RA 1..1578 9..1586 97   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:30:00 Download gff for FI13109.complete
Subject Subject Range Query Range Percent Splice Strand
DNApol-epsilon58-RA 1..1578 9..1586 97   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-14 11:37:26 Download gff for FI13109.complete
Subject Subject Range Query Range Percent Splice Strand
Pole2-RA 1..1632 9..1640 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:28:08 Download gff for FI13109.complete
Subject Subject Range Query Range Percent Splice Strand
Pole2-RA 1..1632 9..1640 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:36:08 Download gff for FI13109.complete
Subject Subject Range Query Range Percent Splice Strand
Pole2-RA 49..1688 1..1640 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:30:00 Download gff for FI13109.complete
Subject Subject Range Query Range Percent Splice Strand
DNApol-epsilon58-RA 49..1688 1..1640 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:30:00 Download gff for FI13109.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5896674..5897387 1..714 98   Minus
3L 5895691..5896616 715..1640 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:36:08 Download gff for FI13109.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5889774..5890487 1..714 98   Minus
arm_3L 5888791..5889716 715..1640 98 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:14:09 Download gff for FI13109.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5889774..5890487 1..714 98   Minus
3L 5888791..5889716 715..1640 98 <- Minus

FI13109.pep Sequence

Translation from 2 to 1585

> FI13109.pep
ITMDVDLLPLRKRITNTFKLCGFLIRSENSSYLAEQLLPFDAAERDKWLT
VITENLQSQKLLTPHVERAALEKAINELNRVGLDEGETVFALIDAFTVPR
FRYNQRIKKFELDTQPRQLLTAPRMKSDYMQQRYAMLLQKTLRHDLFAPA
VIQDGVGAEAQAKKFKLQFAENLLATSAMKEAVVLGLLTQLKEGKFYVED
PTGCVQLDLTGARFHAGFFCEGCFVLAEGNYNNGVLKVDGLGFPPAEPAN
SSRAFFGTANTWGGESAKLLKYSAGLQELERTNTETTIVFLSDVRLDLPV
VMEKLRQLFVGYDSCPPQAIVLMGPFTASTRNHHELRHHLDALGGLAAGC
EQLKKQTDLILVPSSEDPTAPNILPRAPIPECLAAGLLKAWPRTQLATNP
CRLQYCTQQIVVCRLDLMAKFCRNTLHFPEDTSQIEQHFARTIVCQGHLV
PIHPIAMPVHWDYDPALWLYPLPDLIVMGDSCQSFSSSQHGCTVLNTGSF
VKSKFAFKVYIPATRTIEDSEIPDELE*

FI13109.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10439-PA 525 GF10439-PA 1..525 3..527 2737 96.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14105-PA 525 GG14105-PA 1..525 3..527 2806 99 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:52:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17033-PA 526 GH17033-PA 3..524 6..527 2539 88.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
DNApol-epsilon58-PA 525 CG10489-PA 1..525 3..527 2751 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12037-PA 526 GI12037-PA 3..524 6..527 2545 89.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21402-PA 525 GL21402-PA 1..525 3..527 2658 93.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10347-PA 525 GA10347-PA 1..525 3..527 2670 93.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13889-PA 525 GM13889-PA 1..525 3..527 2789 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:52:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13171-PA 525 GD13171-PA 1..525 3..527 2812 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13306-PA 526 GJ13306-PA 3..524 6..527 2555 89.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17530-PA 531 GK17530-PA 1..529 3..527 2490 87.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:52:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20528-PA 525 GE20528-PA 1..525 3..527 2796 98.7 Plus

FI13109.hyp Sequence

Translation from 2 to 1585

> FI13109.hyp
ITMDVDLLPLRKRITNTFKLCGFLIRSENSSYLAEQLLPFDAAERDKWLT
VITENLQSQKLLTPHVERAALEKAINELNRVGLDEGETVFALIDAFTVPR
FRYNQRIKKFELDTQPRQLLTAPRMKSDYMQQRYAMLLQKTLRHDLFAPA
VIQDGVGAEAQAKKFKLQFAENLLATSAMKEAVVLGLLTQLKEGKFYVED
PTGCVQLDLTGARFHAGFFCEGCFVLAEGNYNNGVLKVDGLGFPPAEPAN
SSRAFFGTANTWGGESAKLLKYSAGLQELERTNTETTIVFLSDVRLDLPV
VMEKLRQLFVGYDSCPPQAIVLMGPFTASTRNHHELRHHLDALGGLAAGC
EQLKKQTDLILVPSSEDPTAPNILPRAPIPECLAAGLLKAWPRTQLATNP
CRLQYCTQQIVVCRLDLMAKFCRNTLHFPEDTSQIEQHFARTIVCQGHLV
PIHPIAMPVHWDYDPALWLYPLPDLIVMGDSCQSFSSSQHGCTVLNTGSF
VKSKFAFKVYIPATRTIEDSEIPDELE*

FI13109.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
DNApol-epsilon58-PA 525 CG10489-PA 1..525 3..527 2751 100 Plus