Clone FI13301 Report

Search the DGRC for FI13301

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:133
Well:1
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG3270-RA
Protein status:FI13301.pep: gold
Sequenced Size:1485

Clone Sequence Records

FI13301.complete Sequence

1485 bp assembled on 2010-04-28

GenBank Submission: BT124867.1

> FI13301.complete
AGTGTGAAAAATGCTGGGCCTGCGACGAGTTCTGCGATTGGGTGCACTGC
GTCAGCTTCGCTCGTTAAGTGGCAAGCCGCAAGGCGATGTCCTTCCCGGG
AGCTGCGGAGTCCTGATAATAGGTGGCGGTGGCATGGGCGCCTCCTCCGC
TTTCTGGCTGAAGTCCCGGGCCCTGCAGCTGGGCCGCAAGCTCAATGTGC
TGGTGGTGGAGCGCGATGCTGGTTACACCAGCGCATCTACAGTGCTTTCT
GTAGGCGGAGTGCGGCAGCAGTTCTCTTTGGCCGAGAACATAGAGATGTC
GCTCTTCGGATACAACTTCGTGGTTAACGGCAGGGAGCATCTGGGCGACG
TGGATCTGTGCTACCAGCCGAACGGCTACCTGATCCTTGCCTCCGAGAAG
GGAGCCCACATCCTAGCAAAGAACTCAAAGCTACAGAACGAGCTGGGGGC
CCGAAATGAGCTGCTAGGCCCGGAGGCACTGCGTCAGCGGTTTCCGTGGT
TGTCCACAGAGGGCGTGGAGCTGGGATGCCACGGGATTGACAAGGAGGGA
TGGTTTGATCCGTGGGCCCTGCTCATGGGCTACAAGAAGAAGGCCCGTGC
ATTGGGGGCGAATTTCGCGAACGGTTCGGTAGTGGGTTTTGAGTGGAACG
ATTCGGGCGGCCTTTCTGGAGCTGTGGTCGACGCCGGAGATGTGTTGCAG
CGCACGGTGAAGTTTGACACGTGCGTTCTGGCAGCGGGAGCGTACTCGGG
TCAGGTGGCGCGTCTGGCAGGGATTGGTGATAAGGAAGCAAAGGAGGCTT
CCCTGAGTGTAGCCCTGCCGGTGGAGCCTCGCAAGCGATACGTCTATGTG
GTTAGCACTCAGGGTAAGAATTGTCCTGGGCTAGCCACACCTCTGACCGT
TGATCCCGATGGCACCTACTTCAGGCGGGACGGTCTTTGCGGCAACTTCC
TGTGCGGCCGCAGTCCAAACGAAGACGAGGAGCCGGAGTGCGAAACGCTG
GACGTGGACCACGGGTACTTTGAAACGGATGTCTGGCCCACACTGGCGAA
CCGAGTTCCTGCTTTTGAGTCTGTGAAGATACAGAGCAGCTGGGCGGGCT
TCTATGACCACAACACATTTGACGCAAACGGCGTCATCGGCAGGCATCCT
CACTACAGCAATCTCTTCATTGCCGCAGGCTTCAGTGGGCACGGCATTCA
GCAGACTCCCGCCGTGGGTCGAGCCATTTCCGAACTAATCTTGGACGGCA
AGTTTACCACACTGGATCTGTCGCGCCTCGGCTTCGAACGCCTTGTAAAC
CAACAGCCTATGCACGAAGTGAATATCGTTTGACAAATTTATCACGGGAG
GATCGTACTTGCCCTTGGTGTGTTTATGTATGTACTTCTTTTATTGCAAT
TTCTGTTGTGTATATAGTAATTTTGTATAGTAAAGTTCACGTTTTAGTCA
CGTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

FI13301.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:16:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG3270-RA 1548 CG3270-RA 96..1548 1..1453 7250 99.9 Plus
Mob4.a 1387 Mob4.a 1254..1387 1453..1320 655 99.2 Minus
Mob4-RA 1497 Mob4-RA 1364..1497 1453..1320 655 99.2 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 22:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2581160..2582389 224..1453 6135 99.9 Plus
chr2R 21145070 chr2R 2580628..2580850 1..223 1115 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG3270-RA 1323 CG3270-PA 1..1323 11..1333 6615 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG3270-RA 1449 CG3270-RA 1..1449 1..1449 7230 99.9 Plus
Mob4-RA 1414 CG3403-RA 1337..1414 1453..1376 390 100 Minus
Mob4-RB 1426 CG3403-RB 1349..1426 1453..1376 390 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG3270-PA 440 CG3270-PA 18..440 62..1330 2141 100 Plus
l(2)37Bb-PA 515 CG10655-PA 110..513 140..1330 992 48.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6693962..6695191 224..1453 6135 99.9 Plus
2R 25286936 2R 6693430..6693652 1..223 1115 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6695161..6696390 224..1453 6135 99.9 Plus
2R 25260384 2R 6694629..6694851 1..223 1115 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:52:59 has no hits.

FI13301.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:18:42 Download gff for FI13301.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2581160..2582389 224..1454 99   Plus
chr2R 2580628..2580850 1..223 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-28 13:58:39 Download gff for FI13301.complete
Subject Subject Range Query Range Percent Splice Strand
CG3270-RA 1..1323 11..1333 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:25:01 Download gff for FI13301.complete
Subject Subject Range Query Range Percent Splice Strand
CG3270-RA 1..1323 11..1333 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:27:05 Download gff for FI13301.complete
Subject Subject Range Query Range Percent Splice Strand
CG3270-RA 1..1323 11..1333 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:18:42 Download gff for FI13301.complete
Subject Subject Range Query Range Percent Splice Strand
CG3270-RA 1..1323 11..1333 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-28 13:58:38 Download gff for FI13301.complete
Subject Subject Range Query Range Percent Splice Strand
CG3270-RA 1..1439 11..1449 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:25:00 Download gff for FI13301.complete
Subject Subject Range Query Range Percent Splice Strand
CG3270-RA 1..1439 11..1449 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:27:05 Download gff for FI13301.complete
Subject Subject Range Query Range Percent Splice Strand
CG3270-RA 1..1449 1..1449 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:18:42 Download gff for FI13301.complete
Subject Subject Range Query Range Percent Splice Strand
CG3270-RA 1..1449 1..1449 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:18:42 Download gff for FI13301.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6693962..6695191 224..1454 99   Plus
2R 6693430..6693652 1..223 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:27:05 Download gff for FI13301.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2581467..2582696 224..1454 99   Plus
arm_2R 2580935..2581157 1..223 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:57:07 Download gff for FI13301.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6695161..6696390 224..1454 99   Plus
2R 6694629..6694851 1..223 100 -> Plus

FI13301.pep Sequence

Translation from 10 to 1332

> FI13301.pep
MLGLRRVLRLGALRQLRSLSGKPQGDVLPGSCGVLIIGGGGMGASSAFWL
KSRALQLGRKLNVLVVERDAGYTSASTVLSVGGVRQQFSLAENIEMSLFG
YNFVVNGREHLGDVDLCYQPNGYLILASEKGAHILAKNSKLQNELGARNE
LLGPEALRQRFPWLSTEGVELGCHGIDKEGWFDPWALLMGYKKKARALGA
NFANGSVVGFEWNDSGGLSGAVVDAGDVLQRTVKFDTCVLAAGAYSGQVA
RLAGIGDKEAKEASLSVALPVEPRKRYVYVVSTQGKNCPGLATPLTVDPD
GTYFRRDGLCGNFLCGRSPNEDEEPECETLDVDHGYFETDVWPTLANRVP
AFESVKIQSSWAGFYDHNTFDANGVIGRHPHYSNLFIAAGFSGHGIQQTP
AVGRAISELILDGKFTTLDLSRLGFERLVNQQPMHEVNIV*

FI13301.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:32:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11066-PA 440 GF11066-PA 1..440 1..440 1967 84.5 Plus
Dana\GF15215-PA 510 GF15215-PA 110..508 47..440 1040 48.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:32:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23218-PA 440 GG23218-PA 1..440 1..440 2181 94.8 Plus
Dere\GG21658-PA 515 GG21658-PA 92..513 26..440 1034 49.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21750-PA 444 GH21750-PA 1..444 1..440 1692 74.6 Plus
Dgri\GH10833-PA 581 GH10833-PA 85..267 26..210 482 54.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:32:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG3270-PA 440 CG3270-PA 1..440 1..440 2310 100 Plus
l(2)37Bb-PA 515 CG10655-PA 98..513 32..440 1047 49.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19297-PA 440 GI19297-PA 1..440 1..440 1703 75.5 Plus
Dmoj\GI17347-PA 511 GI17347-PA 87..508 26..438 1010 48.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25633-PA 518 GL25633-PA 87..516 20..440 1084 50 Plus
Dper\GL11115-PA 254 GL11115-PA 1..254 189..440 1067 78.7 Plus
Dper\GL11114-PA 170 GL11114-PA 1..168 1..167 602 72.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17085-PA 441 GA17085-PA 1..441 1..440 1845 78.5 Plus
Dpse\GA10471-PA 518 GA10471-PA 87..516 20..440 1088 50.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:32:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20893-PA 440 GM20893-PA 1..440 1..440 2236 97.5 Plus
Dsec\GM17037-PA 515 GM17037-PA 92..513 26..440 1025 49.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:32:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17890-PA 214 GD17890-PA 1..214 227..440 1131 97.7 Plus
Dsim\GD21785-PA 515 GD21785-PA 92..513 26..440 1022 48.8 Plus
Dsim\GD15335-PA 89 GD15335-PA 1..72 1..72 278 91.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22174-PA 441 GJ22174-PA 1..441 1..440 1733 76.5 Plus
Dvir\GJ16110-PA 510 GJ16110-PA 87..507 26..438 1056 52 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:32:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23230-PA 448 GK23230-PA 1..448 1..440 1650 69.6 Plus
Dwil\GK24840-PA 518 GK24840-PA 94..516 26..440 1050 49.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:32:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19071-PA 440 GE19071-PA 1..440 1..440 2150 93.6 Plus
Dyak\GE12678-PA 515 GE12678-PA 92..513 26..440 1061 48.4 Plus

FI13301.hyp Sequence

Translation from 10 to 1332

> FI13301.hyp
MLGLRRVLRLGALRQLRSLSGKPQGDVLPGSCGVLIIGGGGMGASSAFWL
KSRALQLGRKLNVLVVERDAGYTSASTVLSVGGVRQQFSLAENIEMSLFG
YNFVVNGREHLGDVDLCYQPNGYLILASEKGAHILAKNSKLQNELGARNE
LLGPEALRQRFPWLSTEGVELGCHGIDKEGWFDPWALLMGYKKKARALGA
NFANGSVVGFEWNDSGGLSGAVVDAGDVLQRTVKFDTCVLAAGAYSGQVA
RLAGIGDKEAKEASLSVALPVEPRKRYVYVVSTQGKNCPGLATPLTVDPD
GTYFRRDGLCGNFLCGRSPNEDEEPECETLDVDHGYFETDVWPTLANRVP
AFESVKIQSSWAGFYDHNTFDANGVIGRHPHYSNLFIAAGFSGHGIQQTP
AVGRAISELILDGKFTTLDLSRLGFERLVNQQPMHEVNIV*

FI13301.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:51:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG3270-PA 440 CG3270-PA 1..440 1..440 2310 100 Plus
l(2)37Bb-PA 515 CG10655-PA 98..513 32..440 1047 49.5 Plus