Clone GH01161 Report

Search the DGRC for GH01161

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:11
Well:61
Vector:pOT2
Associated Gene/TranscriptTraf6-RA
Protein status:GH01161.pep: gold
Preliminary Size:2776
Sequenced Size:2785

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10961 2001-01-01 Release 2 assignment
CG10961 2001-07-04 Blastp of sequenced clone
CG10961 2003-01-01 Sim4 clustering to Release 3
Traf2 2008-04-29 Release 5.5 accounting
Traf6 2008-08-15 Release 5.9 accounting
Traf6 2008-12-18 5.12 accounting

Clone Sequence Records

GH01161.complete Sequence

2785 bp (2785 high quality bases) assembled on 2001-07-04

GenBank Submission: AY047501

> GH01161.complete
TTGGATACACAGCTGTTCCGCGGAGTCATGAACGAAAATTATTATTAAAA
TTGAATTAGTTGATTCAAAGAGGATAGCCAGCAGGCGGCCAGAGGAGCAG
CCAAGATGCAGCGAGTCCAGGCCGACCAAAAGCCAGCCAGAATGCACCAG
CATGCACATACGCATTCGCACGCGCACAGTTTGCAGCATGCGGAGGAGAA
GGAGCACAATAGCAATGAGATGACGACCAACTTGTCGTCGACTGGCCGAA
TTGCGGCCAGTAGCAGTGCCACGCCCAGCGCAGCAGCGGGAGGCGGGGCC
AGCGGAGCACCCACTCCGCCCAAGAGTCTGGCGCTCAATCAGAACCATCA
CTATGCACCCGGTTCGGATACATCCGGGGAACAGGAGGAGGAGCTGCTGG
ACTCGCGATACGAGTGCGCCATTTGCATCGATTGGCTAAATGAGCCGGTG
TTGACGTCGTGCGGCCATCGATTTTGTCGCAGCTGCCTCACCGCCTGGAT
GCAAAAGAACAATCAATGCTGCCCCATGGACAACAAGCGTCTGTCCGCCG
AGCACGACATCTTTCCGGACAACTACACGCGCCGCGAGATCGAGCAACTC
AAGCGAGATTGCCCCAACTCCTCGCTGGGCTGTTCGGTGGTTGCCTCGCC
CATCGAACTGCATCGCCATCTGCCCAGTTGTCCCTATCGGCGGCAGCAGG
AGCCGCAGGAGGAGAAGTGCCCGTTTGCCAAGATCAAGTGCGATTTTGTG
GGCCGACCAGAGACCAATCAGTTGGAGGAGCACCTCAAGGCCGACATGCC
GCATCACATGCAGCTGATGCTGCAGGCATTCCAGCAGACAGCCATTGCCA
CCTGGCAGCCACACAAGCCCAGCACAAGTGGCGCCGCCGTGGAGAATGGT
CATGGCCAGCAGCAGCTGCCGCCACCGCCGCAATATGCCAATGGTGTGGA
TGAGCAGATTGTGCAAACGATGTACCAGAGAATTGTGGTTTTGGAACAGC
GGACACGCGAGCAGGAGACGCGACTGGAGAATATGCAAAAGCAGCTGCGT
CTGGCACGCCAGCAGGCGCCCGTTGATCCGCGCTACAGCAATGGCACGAT
TGTGTGGCGCATCGAGCAGCTGGGCGCCTTGGTGGCTCGCCTGCGGGCCA
ATGCCAACAATCAAGTGTACTCGCACGAGTGCTACACCTCGCCGCATGGC
TACAAGTTCTGTGCGCGGCTGAACATTCAGCCGCGGAAACCGCATGTGCT
CAGCTTGCATGTGCATCTGATGCAGTCGGAGAACGATTACCACTTGGACT
GGCCCTTCAAGGGTCGCATCAAGTTGTGCATGGTGCATCCGGCAGATGCG
ACGTTGTCGCAGCACGACACCATCATGACCAAGCCGGAGATTCTGGCGTT
CCACAAGCCACGCGAAGCGATCAGCACACGGGGATTCGGTTTCCTCGAGT
ACGCCAACATATCGAACATCATACAGCTGGGCTTCTGCGCCGACGATCGG
CTGCTCATCAAGATCGAGATCAATATTGTGTGAATTGGCAATGGAAAAGG
AAATGGAAACGCGGCGGCACCGATGTCTTCCGATTGCGTTAAGTTTGCAC
CAAGGTGGATCGTGAATCATAGGGACCCAAAGGTAAACCGTGCAAGTAGA
GAAAAATAGCCAGGTATTAGAAATACATAAGTACGCATGGTAGCAATCAT
AATTGTCATCTTTTTGAAGCGAATTCATTCCTCTAGCAGTGTGAATTCGT
TCCCTAGATAGACAATAATCCCATCTCCAAGGAGTGCTAGCCTAATGCTT
GACCTGTTATCACCGTGGCAATATAGTTTAGAACTACTGATAACAAGGCG
ACCCCGCGATTTGTGTGAAATTAGTCGATCGATCCACTTTAGTGAACTCG
TGCGCCAACGTACAACAATATGCAATACCCGATAGCTGACACACACGTAT
ATATATTTTATATAGACCTATATATATATAGTATACGAGAGACCGCTAAT
AGTCACCGTCTAGCAAGCATCACATTAAGCAATCTTGATGATATTCAAAT
ACTAATCGATATTAGCCTAGTATCCTAGAACTATCTCTTATTCTCTATTT
GTATTTCTAGTGCTATACTATTACTTACTATTGGTTCTAGTGAACAAAAG
TCAATGCAGATCACGTAAATACATAGGTCTATAATTGGAAAACTTAGTTG
GTCTTGGGTTTACCCGTGATACCTTATCAATGCATTTTCAGTGCTTAATT
AATCTTTAGTTTTCAAAACATTCTCGTCAATTTGATTGATTTTAACTATA
TTTGTAACTGAGTACGTCCATTTGGCAGAAATGTCAGCCCTATTTTAAAC
TAGTTTACTTAATATTGCATCTAGAATTATGCTAGGTTTTAATTCTTCAG
TTTATCGCTTCGAAAAACTAGTAATGAGTGAACCGACCAGCGCATAGAAT
ATAAAATATGTACCTTTTTTGAAAACAACGAAGGGGCGGGAATATATTTT
TTTAACCTTTAACGCAAAAGCCTCCGTTTATGATCATCAATTTCGTTTGG
AAAAAAAAAAAAAAAAACAACAAAGGCTGTATGTATTATTTTATCCCAAT
ACTTAACTTAGTCCATAGCGATACGAACTACATGTTTAGAGCTAAGAATC
CCGGGTAGAATGCACACGCTGGCAAGGATTAGAGCCCAGACTCATCTGGA
CTTGGATCGCTGACAGCTTGGAACCCTCTCCGTTTAGGAAACCCCAATAA
AGGACACTTTTGTACCGCAAAAAAAAAAAAAAAAA

GH01161.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
Traf6-RA 2777 Traf6-RA 1..2771 1..2771 13855 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8046435..8049202 2768..1 13690 99.6 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
Traf6-RA 1428 CG10961-PA 1..1428 106..1533 7140 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:25:22 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
Traf6-RA 2788 CG10961-RA 21..2788 1..2768 13840 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
Traf6-PA 475 CG10961-PA 1..467 106..1506 2074 100 Plus
CG9014-PB 328 CG9014-PB 10..108 376..687 162 35.2 Plus
CG9014-PA 328 CG9014-PA 10..108 376..687 162 35.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8154596..8157366 2771..1 13855 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:00:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8162694..8165464 2771..1 13855 100 Minus
Blast to na_te.dros performed on 2014-11-27 10:19:09 has no hits.

GH01161.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 12:25:05 Download gff for GH01161.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8046435..8049202 1..2768 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:02:39 Download gff for GH01161.complete
Subject Subject Range Query Range Percent Splice Strand
Traf6-RA 1..1428 106..1533 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:30:28 Download gff for GH01161.complete
Subject Subject Range Query Range Percent Splice Strand
Traf6-RA 1..1428 106..1533 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:07:35 Download gff for GH01161.complete
Subject Subject Range Query Range Percent Splice Strand
Traf6-RA 1..1428 106..1533 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:03:57 Download gff for GH01161.complete
Subject Subject Range Query Range Percent Splice Strand
Traf6-RA 1..1428 106..1533 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:25:05 Download gff for GH01161.complete
Subject Subject Range Query Range Percent Splice Strand
Traf6-RA 1..1428 106..1533 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:31:18 Download gff for GH01161.complete
Subject Subject Range Query Range Percent Splice Strand
Traf6-RA 1..2768 1..2768 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:30:28 Download gff for GH01161.complete
Subject Subject Range Query Range Percent Splice Strand
Traf6-RA 1..2768 1..2768 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:07:35 Download gff for GH01161.complete
Subject Subject Range Query Range Percent Splice Strand
Traf6-RA 21..2788 1..2768 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:03:57 Download gff for GH01161.complete
Subject Subject Range Query Range Percent Splice Strand
Traf6-RA 1..2768 1..2768 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:25:05 Download gff for GH01161.complete
Subject Subject Range Query Range Percent Splice Strand
Traf6-RA 21..2788 1..2768 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 12:25:05 Download gff for GH01161.complete
Subject Subject Range Query Range Percent Splice Strand
X 8154599..8157366 1..2768 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:07:35 Download gff for GH01161.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8048632..8051399 1..2768 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:42:05 Download gff for GH01161.complete
Subject Subject Range Query Range Percent Splice Strand
X 8162697..8165464 1..2768 100   Minus

GH01161.pep Sequence

Translation from 105 to 1532

> GH01161.pep
MQRVQADQKPARMHQHAHTHSHAHSLQHAEEKEHNSNEMTTNLSSTGRIA
ASSSATPSAAAGGGASGAPTPPKSLALNQNHHYAPGSDTSGEQEEELLDS
RYECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCPMDNKRLSAEH
DIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEP
QEEKCPFAKIKCDFVGRPETNQLEEHLKADMPHHMQLMLQAFQQTAIATW
QPHKPSTSGAAVENGHGQQQLPPPPQYANGVDEQIVQTMYQRIVVLEQRT
REQETRLENMQKQLRLARQQAPVDPRYSNGTIVWRIEQLGALVARLRANA
NNQVYSHECYTSPHGYKFCARLNIQPRKPHVLSLHVHLMQSENDYHLDWP
FKGRIKLCMVHPADATLSQHDTIMTKPEILAFHKPREAISTRGFGFLEYA
NISNIIQLGFCADDRLLIKIEINIV*

GH01161.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20974-PA 476 GF20974-PA 20..476 21..475 1835 78.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17981-PA 475 GG17981-PA 1..475 1..475 2392 97.5 Plus
Dere\GG10187-PA 332 GG10187-PA 10..106 91..192 151 35.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24860-PA 480 GH24860-PA 76..480 70..475 1799 80.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
Traf6-PA 475 CG10961-PA 1..475 1..475 2563 100 Plus
CG9014-PB 328 CG9014-PB 10..108 91..194 162 35.2 Plus
CG9014-PA 328 CG9014-PA 10..108 91..194 162 35.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14410-PA 480 GI14410-PA 79..480 70..475 1811 83.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20189-PA 445 GL20189-PA 1..445 1..475 1829 74.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10670-PA 464 GA10670-PA 1..464 1..475 1952 77.5 Plus
Dpse\GA27790-PA 69 GA27790-PA 8..58 208..258 255 90.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11204-PA 468 GM11204-PA 1..468 1..475 2219 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16124-PA 87 GD16124-PA 1..87 389..475 480 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:34:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18758-PA 480 GJ18758-PA 56..480 48..475 1816 80.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:34:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19915-PA 468 GK19915-PA 49..468 70..475 1680 73.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17475-PA 475 GE17475-PA 1..475 1..475 2380 96.8 Plus
Dyak\GE11492-PA 332 GE11492-PA 10..106 91..192 151 35.9 Plus

GH01161.hyp Sequence

Translation from 105 to 1532

> GH01161.hyp
MQRVQADQKPARMHQHAHTHSHAHSLQHAEEKEHNSNEMTTNLSSTGRIA
ASSSATPSAAAGGGASGAPTPPKSLALNQNHHYAPGSDTSGEQEEELLDS
RYECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCPMDNKRLSAEH
DIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEP
QEEKCPFAKIKCDFVGRPETNQLEEHLKADMPHHMQLMLQAFQQTAIATW
QPHKPSTSGAAVENGHGQQQLPPPPQYANGVDEQIVQTMYQRIVVLEQRT
REQETRLENMQKQLRLARQQAPVDPRYSNGTIVWRIEQLGALVARLRANA
NNQVYSHECYTSPHGYKFCARLNIQPRKPHVLSLHVHLMQSENDYHLDWP
FKGRIKLCMVHPADATLSQHDTIMTKPEILAFHKPREAISTRGFGFLEYA
NISNIIQLGFCADDRLLIKIEINIV*

GH01161.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
Traf6-PA 475 CG10961-PA 1..475 1..475 2563 100 Plus
CG9014-PB 328 CG9014-PB 10..108 91..194 162 35.2 Plus
CG9014-PA 328 CG9014-PA 10..108 91..194 162 35.2 Plus