Clone GH01278 Report

Search the DGRC for GH01278

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:12
Well:78
Vector:pOT2
Associated Gene/TranscriptPI31-RA
Protein status:GH01278.pep: gold
Preliminary Size:1105
Sequenced Size:1121

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8979 2001-01-01 Release 2 assignment
CG8979 2001-09-19 Blastp of sequenced clone
CG8979 2003-01-01 Sim4 clustering to Release 3
CG8979 2008-04-29 Release 5.5 accounting
CG8979 2008-08-15 Release 5.9 accounting
CG8979 2008-12-18 5.12 accounting

Clone Sequence Records

GH01278.complete Sequence

1121 bp (1121 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058250

> GH01278.complete
CAATATTAACAAAGTCATTTATAATTTATTATTATTTAAACAATATAGAT
CCTTTTAAAAAACATTGAGCTAAGATTTTGTAAAGGATTATCGGTGGCCG
CAATGGAAAGTGGGTCGACTGCCAAGACGGGCGATTTCTTTTACGGTTGG
GATCTGCTGTACAAGACCGTTAAGGCTGATGTCTCCAAGAAGTCAGACCT
TTTGATTGCCCTCGTCCATTTTCTTTTGACCAAGCATTACAACTTCCGAT
GCGTTGGCGTTGGCGATGATAAAACCTTGCCGGAGGAGGAGGGCAGTGAG
CTGCTGCCGGACAGCTGGAATGATGACGATACCAAGTACTCGCTGCGCTA
CGTGCACGATAAGATGCTGTATTTGCTGCTGGGCCACATCACCGAGGGCT
CCCTGCTGATCAACCTGTTGGACATCAACACTAAGAAGGTATCCAACATC
TGCGTAGAACCAGAGACCCTGGTACCTGAGGTCAAGGGAGGCATCACCAC
CATAATGCCGAGTGCCTCAGAGATTGTTGAACGCTACCGTAGGGAGCTTC
TAGACCCTGTATTCACGGGAAACTCGCGCGAAGTTACCACGCAGACGACC
AACTCACCACGCCCCATTGGATCGGATCCAGATCCCTTGCGCATCGGCGA
GCCAAGGCGTGGCGGATCCTTCATTCCAAGTGCATTCGAGCCTCGCCCTT
TTGGATTTCCGGACGTTGGACGCGGGGATCTCGATCCACTGGGTCGCGGT
GGTCATGGTAACCTGTTCAGCTTTCCATCACGCCCAAATATGGGCCCGGG
ACCCGTGCCCCGCTTCGACCCGTTCAATCCCCTGAACCCGAATAGGCCGG
GACAGGGTGGAATCAATCCAGATCATATGCGCCCACCAGATTGGAATCCC
GATTACTACATGTAATTACCAGGAATGCCATGTATAGTGAGCAATTCAAA
TCTTTAGTTTAAAGCAATGAAAAAAGTTTTCATTTTAGAAGACCAAAATT
AAACGGATTGTTTTAAAAGATTATTTTTATTACGTTGCATACACAATACA
GAATATTACAGAATTTTACAGATATAAAATAAAAAACAGCAGCCTGTTAG
ACAAAAAAAAAAAAAAAAAAA

GH01278.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG8979-RA 1268 CG8979-RA 56..1159 1..1104 5520 100 Plus
CG8979.f 1467 CG8979.f 255..1358 1..1104 5520 100 Plus
CG8979.a 1172 CG8979.a 136..1167 73..1104 5160 100 Plus
CG8979.a 1172 CG8979.a 31..105 1..75 375 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:29:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7854560..7854997 1102..665 2190 100 Minus
chr2R 21145070 chr2R 7855054..7855448 665..271 1975 100 Minus
chr2R 21145070 chr2R 7855501..7855698 270..73 990 100 Minus
chr2R 21145070 chr2R 7855957..7856030 74..1 370 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:29:42
Subject Length Description Subject Range Query Range Score Percent Strand
PI31-RF 813 CG8979-PF 1..813 103..915 4065 100 Plus
PI31-RD 813 CG8979-PD 1..813 103..915 4065 100 Plus
PI31-RB 813 CG8979-PB 1..813 103..915 4065 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:25:39 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:29:40
Subject Length Description Subject Range Query Range Score Percent Strand
PI31-RA 1139 CG8979-RA 38..1139 1..1102 5510 100 Plus
PI31-RF 1172 CG8979-RF 143..1172 73..1102 5150 100 Plus
PI31-RB 1203 CG8979-RB 174..1203 73..1102 5150 100 Plus
PI31-RF 1172 CG8979-RF 38..112 1..75 375 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:29:44
Subject Length Description Subject Range Query Range Score Percent Strand
PI31-PF 270 CG8979-PF 1..270 103..912 1374 100 Plus
PI31-PD 270 CG8979-PD 1..270 103..912 1374 100 Plus
PI31-PB 270 CG8979-PB 1..270 103..912 1374 100 Plus
PI31-PC 270 CG8979-PC 1..270 103..912 1374 100 Plus
PI31-PA 270 CG8979-PA 1..270 103..912 1374 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:29:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11967341..11967780 1104..665 2200 100 Minus
2R 25286936 2R 11967837..11968231 665..271 1975 100 Minus
2R 25286936 2R 11968284..11968481 270..73 990 100 Minus
2R 25286936 2R 11968740..11968813 74..1 370 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:47:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11968540..11968979 1104..665 2200 100 Minus
2R 25260384 2R 11969036..11969430 665..271 1975 100 Minus
2R 25260384 2R 11969483..11969680 270..73 990 100 Minus
2R 25260384 2R 11969939..11970012 74..1 370 100 Minus
Blast to na_te.dros performed 2014-11-27 08:29:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_O 2986 Dbif\P-element_O P_O 2986bp Derived from X71634. 2019..2095 81..2 113 63.7 Minus

GH01278.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:10:17 Download gff for GH01278.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7855501..7855696 75..270 100 <- Minus
chr2R 7855054..7855448 271..665 100 <- Minus
chr2R 7854560..7854996 666..1102 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:03:07 Download gff for GH01278.complete
Subject Subject Range Query Range Percent Splice Strand
CG8979-RB 1..813 103..915 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:10:57 Download gff for GH01278.complete
Subject Subject Range Query Range Percent Splice Strand
CG8979-RB 1..813 103..915 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:02:19 Download gff for GH01278.complete
Subject Subject Range Query Range Percent Splice Strand
PI31-RB 1..813 103..915 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:41:50 Download gff for GH01278.complete
Subject Subject Range Query Range Percent Splice Strand
CG8979-RB 1..813 103..915 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:10:17 Download gff for GH01278.complete
Subject Subject Range Query Range Percent Splice Strand
PI31-RB 1..813 103..915 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:02:16 Download gff for GH01278.complete
Subject Subject Range Query Range Percent Splice Strand
CG8979-RA 31..1132 1..1102 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:10:57 Download gff for GH01278.complete
Subject Subject Range Query Range Percent Splice Strand
CG8979-RA 31..1132 1..1102 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:02:19 Download gff for GH01278.complete
Subject Subject Range Query Range Percent Splice Strand
PI31-RA 38..1139 1..1102 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:41:50 Download gff for GH01278.complete
Subject Subject Range Query Range Percent Splice Strand
CG8979-RA 31..1132 1..1102 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:10:17 Download gff for GH01278.complete
Subject Subject Range Query Range Percent Splice Strand
PI31-RA 38..1139 1..1102 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:10:17 Download gff for GH01278.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11968740..11968813 1..74 100   Minus
2R 11968284..11968479 75..270 100 <- Minus
2R 11967837..11968231 271..665 100 <- Minus
2R 11967343..11967779 666..1102 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:02:19 Download gff for GH01278.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7856245..7856318 1..74 100   Minus
arm_2R 7855789..7855984 75..270 100 <- Minus
arm_2R 7855342..7855736 271..665 100 <- Minus
arm_2R 7854848..7855284 666..1102 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:19:32 Download gff for GH01278.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11969939..11970012 1..74 100   Minus
2R 11969483..11969678 75..270 100 <- Minus
2R 11969036..11969430 271..665 100 <- Minus
2R 11968542..11968978 666..1102 100 <- Minus

GH01278.pep Sequence

Translation from 102 to 914

> GH01278.pep
MESGSTAKTGDFFYGWDLLYKTVKADVSKKSDLLIALVHFLLTKHYNFRC
VGVGDDKTLPEEEGSELLPDSWNDDDTKYSLRYVHDKMLYLLLGHITEGS
LLINLLDINTKKVSNICVEPETLVPEVKGGITTIMPSASEIVERYRRELL
DPVFTGNSREVTTQTTNSPRPIGSDPDPLRIGEPRRGGSFIPSAFEPRPF
GFPDVGRGDLDPLGRGGHGNLFSFPSRPNMGPGPVPRFDPFNPLNPNRPG
QGGINPDHMRPPDWNPDYYM*

GH01278.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:20:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11798-PA 264 GF11798-PA 3..264 7..270 1135 82 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:20:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22619-PA 268 GG22619-PA 1..268 1..270 1278 89.6 Plus
Dere\GG18791-PA 223 GG18791-PA 26..199 14..180 251 35.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:20:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20402-PA 268 GH20402-PA 8..268 3..270 976 70 Plus
Dgri\GH12341-PA 64 GH12341-PA 14..63 42..91 162 64.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:20:15
Subject Length Description Subject Range Query Range Score Percent Strand
PI31-PF 270 CG8979-PF 1..270 1..270 1469 100 Plus
PI31-PD 270 CG8979-PD 1..270 1..270 1469 100 Plus
PI31-PB 270 CG8979-PB 1..270 1..270 1469 100 Plus
PI31-PC 270 CG8979-PC 1..270 1..270 1469 100 Plus
PI31-PA 270 CG8979-PA 1..270 1..270 1469 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19589-PA 271 GI19589-PA 9..271 4..270 973 71.7 Plus
Dmoj\GI15589-PA 260 GI15589-PA 8..260 3..270 767 55 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10241-PA 270 GL10241-PA 1..270 1..270 1006 72.7 Plus
Dper\GL22943-PA 230 GL22943-PA 34..201 6..159 271 36.3 Plus
Dper\GL22949-PA 135 GL22949-PA 34..119 6..79 167 41.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:20:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21450-PA 270 GA21450-PA 1..270 1..270 1006 72.7 Plus
Dpse\GA22373-PA 548 GA22373-PA 41..198 13..156 265 37.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:20:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20399-PA 102 GM20399-PA 1..99 1..99 518 98 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:20:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25873-PA 268 GD25873-PA 1..268 1..270 1340 95.6 Plus
Dsim\GD16758-PA 236 GD16758-PA 41..193 14..159 241 34.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18358-PA 270 GJ18358-PA 7..270 2..270 965 70 Plus
Dvir\GJ15195-PA 262 GJ15195-PA 10..262 3..270 746 55.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:20:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22249-PA 280 GK22249-PA 18..280 11..270 883 68.9 Plus
Dwil\GK25729-PA 241 GK25729-PA 17..198 11..175 302 37.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:20:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13488-PA 270 GE13488-PA 1..270 1..270 1323 92.6 Plus
Dyak\GE16436-PA 232 GE16436-PA 34..208 14..180 238 34.3 Plus

GH01278.hyp Sequence

Translation from 102 to 914

> GH01278.hyp
MESGSTAKTGDFFYGWDLLYKTVKADVSKKSDLLIALVHFLLTKHYNFRC
VGVGDDKTLPEEEGSELLPDSWNDDDTKYSLRYVHDKMLYLLLGHITEGS
LLINLLDINTKKVSNICVEPETLVPEVKGGITTIMPSASEIVERYRRELL
DPVFTGNSREVTTQTTNSPRPIGSDPDPLRIGEPRRGGSFIPSAFEPRPF
GFPDVGRGDLDPLGRGGHGNLFSFPSRPNMGPGPVPRFDPFNPLNPNRPG
QGGINPDHMRPPDWNPDYYM*

GH01278.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:16:33
Subject Length Description Subject Range Query Range Score Percent Strand
PI31-PF 270 CG8979-PF 1..270 1..270 1469 100 Plus
PI31-PD 270 CG8979-PD 1..270 1..270 1469 100 Plus
PI31-PB 270 CG8979-PB 1..270 1..270 1469 100 Plus
PI31-PC 270 CG8979-PC 1..270 1..270 1469 100 Plus
PI31-PA 270 CG8979-PA 1..270 1..270 1469 100 Plus