Clone GH01388 Report

Search the DGRC for GH01388

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:13
Well:88
Vector:pOT2
Associated Gene/TranscriptCG12071-RA
Protein status:GH01388.pep: wuzgold
Preliminary Size:2273
Sequenced Size:2092

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12071 2001-01-01 Release 2 assignment
CG12071 2001-07-04 Blastp of sequenced clone
CG12071 2003-01-01 Sim4 clustering to Release 3
CG12071 2008-04-29 Release 5.5 accounting
CG12071 2008-08-15 Release 5.9 accounting
CG12071 2008-12-18 5.12 accounting

Clone Sequence Records

GH01388.complete Sequence

2092 bp (2092 high quality bases) assembled on 2001-07-04

GenBank Submission: AY060224

> GH01388.complete
GGAAGTAGACGACGGCGAATCCTTGGCGGCTCAGCATTTCCACCGAATTC
GCGTCGAGGAAAAGCGGAAAATCGGAAAAGCAGCGACCATTCTCGTATTG
ATTTTCAAGTGTGATCGGCGCCGTTAACATGGATAAGATGACGGTTGCCC
AGAAGAACGCATATCTCGAGGCGCACATGGCGGTGCAGCAGCAGATGGCC
CAGGCGGCCATTCAGTTCAAGCAGCAGCAGACGTCCCAGCAACAGAACTC
CCCCACGGCCAACAACAACAACAACAGCCAGAACAATGGCAACATGCAGC
AGCAACAGCAGCAGCAGCAGCAGCAACAGCAGCAGCAGCAGCAACAACAG
CAGCAGCAGCATTATGCAGCAACCATCAAGGTGCCGCAGATCAGTTCCTC
CAATGTGGCAGCCGCGGCGGCGGGGGAGAGCACCTTCACAGTTCCGGACG
ACGGAATGGGATTCGAAGGAGGCGTGCGGGTCCTGCAGAGTCTGGGAACC
TGGTCGGCGGCCGAGCAACTGACCTACAACATCCCCAAGCCCAACCTCAT
CCCCTTCACAGAGCCCTATGTCGAGGGGGGCTCCATGCACCCCGCCAGTC
GACTCAAGGCCCTGCAACAGGTGCAACAGGCATCCTCCGGGGTGCGCAAG
ACAAATCCCTCAAAGTCCACCAACAAGGCATTCGAGTGCACGGTCTGCGG
CAAAGGACTCGCCCGCAAGGACAAGCTGACCATCCACATGCGCATCCACA
CCGGCGAGAAGCCCTATATTTGTGAAGTATAAGCTGCCCTCGAGCCCCGC
ACCTCTAGCCTCGATCATCTAATCTAACCCTCGCTCTCGAATCCTTCATT
TCAGGTGTGCAATAAGGCGTTCGCAAGGCGGGACAAGCTGGTGATTCACA
TGAACAAGTTCAAGCACGTGACGCCCACGAACATTGCACCACTCGGAAAG
CGGCTGAACAACATGGTGAAGAAGAAGGAGCAGCCGGATCCGCCGCCGGA
GGACAACAAGCAGAGCCTGGAGCTGCAGCTGCAGCAGCAGGCGGTCCAGG
TGGCCGCCCAGAACATAATAGTGCAATCTGCTCAAGGAGCGCCGACGTCG
ATTCCCGGTATCATCATACCGCACCATCAGCAGCAATTGTCGTGGACGTG
CGAGCTGTGCGGCAGGATGTTCTCGAGTCGGGACGAGTGGTCCATTCACG
CCAAGAGTCATCTGGAGTATTGACAGCCGGAACGGCTAGTCGCAGAGTCA
ACAAAACCAGCAGCAGCGGCGGCAGGAGTCATTGCTAAGACCACCAGCAG
CAACAACAGTCGCAACTATCAAATGGATGCTAATCAAAACCAAATTCAGA
TGGAGGCCCAAGCACGAAAACAGAAGATAATCATTCAAAACCAGATGATA
CTCAATGCCAGCCACCAGCAGCAGCAGCAGCCGCAGCAACATCCGCAACA
GCAGCAGCACCAACAGCAGCAGCAGCAACACGTGGCCCACGGAAAGAAGG
CAGCCAGAAAACACCAGCAACATCTGCAGCAACAGCAGCAGCAACAGCAA
CAGCAACAGCAACAGCAACAGCAGCAGCAGCAACAGACCAGTGCGCCTAT
GTACAATAACAATAGTAGTAGCAACCACAACGGCAACAACCAAAGCCAAG
AAGTGTCGGTGCCGGTGTCGCACATCATTGCCAATTCGCCGACGGCCGCC
ACGTATATGCAGGCCCAGCTGAGCGAGCACGCCAGCAACATGCAGCACGG
CATGCCCATTGTCACGTACAATGGGAACCAGTACTGCGTGATTACCCGTG
CCCCGGATCTGGATGTGGAGGCGATGCAGAAGCCGCTGGACTATGGCCAC
GCAGCCGGAGGAGCCACCAACATAATAGTAATGTCGCCGATGCAACTGCT
GCCCCCCCAGCAGCAGCAGCAGCAGCCGCAACAGCAACAGCAGCAGCAGT
AAGCACCATCGAAGAGAAAGGCTAACTGACTGGCCAATCAGCTATAAATA
CGAATTGTAAATAAAGTCTTAAGCAGCCGAGAGCAACCCTAAGTATATGT
TTAACAACACTACCCAGCAAAACTAAAAAAAAAAAAAAAAAA

GH01388.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG12071-RA 2935 CG12071-RA 370..2459 1..2090 10405 99.8 Plus
CG12071-RB 2505 CG12071-RB 1164..2029 1225..2090 4285 99.6 Plus
CG12071-RB 2505 CG12071-RB 27..804 1..778 3890 100 Plus
CG12071-RB 2505 CG12071-RB 803..1165 855..1217 1815 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 22:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26701826..26702379 666..113 2755 99.8 Minus
chr3R 27901430 chr3R 26701164..26701714 1217..667 2725 99.6 Minus
chr3R 27901430 chr3R 26700042..26700463 2074..1653 2080 99.5 Minus
chr3R 27901430 chr3R 26700611..26701059 1654..1212 2045 97.6 Minus
chr3R 27901430 chr3R 26703239..26703351 113..1 565 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:31:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG12071-RE 1746 CG12071-PE 649..1746 855..1952 5490 100 Plus
CG12071-RD 1746 CG12071-PD 649..1746 855..1952 5490 100 Plus
CG12071-RE 1746 CG12071-PE 1..650 129..778 3250 100 Plus
CG12071-RD 1746 CG12071-PD 1..650 129..778 3250 100 Plus
CG12071-RG 1017 CG12071-PG 1..650 129..778 3250 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:25:50 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:31:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG12071-RE 2640 CG12071-RE 929..2148 855..2074 6100 100 Plus
CG12071-RD 2155 CG12071-RD 929..2148 855..2074 6100 100 Plus
CG12071-RG 2155 CG12071-RG 929..2148 855..2074 6100 100 Plus
CG12071-RE 2640 CG12071-RE 153..930 1..778 3890 100 Plus
CG12071-RD 2155 CG12071-RD 153..930 1..778 3890 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:31:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG12071-PE 581 CG12071-PE 1..562 129..1892 1793 95.4 Plus
CG12071-PD 581 CG12071-PD 1..562 129..1892 1793 95.4 Plus
CG12071-PG 338 CG12071-PG 1..338 129..1220 1062 92.9 Plus
CG12071-PF 338 CG12071-PF 1..338 129..1220 1062 92.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30879354..30879907 666..113 2770 100 Minus
3R 32079331 3R 30878692..30879242 1217..667 2755 100 Minus
3R 32079331 3R 30878145..30878587 1654..1212 2200 99.8 Minus
3R 32079331 3R 30877560..30877997 2090..1653 2145 99.3 Minus
3R 32079331 3R 30880763..30880875 113..1 565 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:00:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30620185..30620738 666..113 2770 100 Minus
3R 31820162 3R 30619523..30620073 1217..667 2755 100 Minus
3R 31820162 3R 30618976..30619418 1654..1212 2200 99.7 Minus
3R 31820162 3R 30618391..30618828 2090..1653 2145 99.3 Minus
3R 31820162 3R 30621594..30621706 113..1 565 100 Minus
3L 28103327 3L 2871411..2871485 1586..1515 200 86.6 Minus
3R 31820162 3R 18336327..18336374 1555..1508 195 93.7 Minus
X 23527363 X 10994628..10994696 356..288 195 85.5 Minus
X 23527363 X 21318389..21318459 1582..1512 190 84.5 Minus
Blast to na_te.dros performed 2014-11-26 22:31:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2596..3002 1250..1655 442 61.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2347..2510 220..389 348 72.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2456..2649 185..373 172 59.2 Plus
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 2635..2687 1602..1654 121 69.8 Plus

GH01388.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 00:55:25 Download gff for GH01388.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26703239..26703351 1..113 100   Minus
chr3R 26702233..26702378 114..259 100 <- Minus
chr3R 26701826..26702130 362..666 100 == Minus
chr3R 26701164..26701714 667..1217 99 <- Minus
chr3R 26700859..26701053 1218..1412 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:03:28 Download gff for GH01388.complete
Subject Subject Range Query Range Percent Splice Strand
CG12071-RB 1..648 129..776 100 == Plus
CG12071-RB 649..1737 855..1952 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:30:20 Download gff for GH01388.complete
Subject Subject Range Query Range Percent Splice Strand
CG12071-RB 649..1737 855..1952 99   Plus
CG12071-RB 1..648 129..776 100 == Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:50:09 Download gff for GH01388.complete
Subject Subject Range Query Range Percent Splice Strand
CG12071-RB 649..1737 855..1952 99   Plus
CG12071-RB 1..648 129..776 100 == Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:03:49 Download gff for GH01388.complete
Subject Subject Range Query Range Percent Splice Strand
CG12071-RB 1..648 129..776 100 == Plus
CG12071-RB 649..1737 855..1952 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:55:25 Download gff for GH01388.complete
Subject Subject Range Query Range Percent Splice Strand
CG12071-RD 649..1746 855..1952 100   Plus
CG12071-RD 1..648 129..776 100 == Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:31:07 Download gff for GH01388.complete
Subject Subject Range Query Range Percent Splice Strand
CG12071-RA 1..2074 1..2074 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:30:20 Download gff for GH01388.complete
Subject Subject Range Query Range Percent Splice Strand
CG12071-RA 1..2074 1..2074 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:50:09 Download gff for GH01388.complete
Subject Subject Range Query Range Percent Splice Strand
CG12071-RC 777..1996 855..2074 100   Plus
CG12071-RC 1..776 1..776 100 == Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:03:50 Download gff for GH01388.complete
Subject Subject Range Query Range Percent Splice Strand
CG12071-RA 1..2074 1..2074 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:55:25 Download gff for GH01388.complete
Subject Subject Range Query Range Percent Splice Strand
CG12071-RG 929..2148 855..2074 100   Plus
CG12071-RG 153..928 1..776 100 == Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 00:55:25 Download gff for GH01388.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30880763..30880875 1..113 100   Minus
3R 30879354..30879906 114..666 100 <- Minus
3R 30878692..30879242 667..1217 100 <- Minus
3R 30878147..30878581 1218..1652 100 <- Minus
3R 30877576..30877997 1653..2074 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:50:09 Download gff for GH01388.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26706485..26706597 1..113 100   Minus
arm_3R 26705076..26705628 114..666 100 <- Minus
arm_3R 26704414..26704964 667..1217 100 <- Minus
arm_3R 26703869..26704303 1218..1652 100 <- Minus
arm_3R 26703298..26703719 1653..2074 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:41:56 Download gff for GH01388.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30621594..30621706 1..113 100   Minus
3R 30620185..30620737 114..666 100 <- Minus
3R 30619523..30620073 667..1217 100 <- Minus
3R 30618978..30619412 1218..1652 100 <- Minus
3R 30618407..30618828 1653..2074 100 <- Minus

GH01388.pep Sequence

Translation from 128 to 781

> GH01388.pep
MDKMTVAQKNAYLEAHMAVQQQMAQAAIQFKQQQTSQQQNSPTANNNNNS
QNNGNMQQQQQQQQQQQQQQQQQQQQQHYAATIKVPQISSSNVAAAAAGE
STFTVPDDGMGFEGGVRVLQSLGTWSAAEQLTYNIPKPNLIPFTEPYVEG
GSMHPASRLKALQQVQQASSGVRKTNPSKSTNKAFECTVCGKGLARKDKL
TIHMRIHTGEKPYICEV*

GH01388.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23308-PA 592 GF23308-PA 1..219 1..217 760 93.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11906-PA 595 GG11906-PA 1..220 1..217 779 98.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14093-PA 235 GH14093-PA 1..235 1..217 789 83.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG12071-PG 338 CG12071-PG 1..217 1..217 1119 100 Plus
CG12071-PF 338 CG12071-PF 1..217 1..217 1119 100 Plus
CG12071-PE 581 CG12071-PE 1..217 1..217 1119 100 Plus
CG12071-PD 581 CG12071-PD 1..217 1..217 1119 100 Plus
Aef1-PB 308 CG5683-PB 29..216 38..217 182 30.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:30:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10626-PA 231 GI10626-PA 1..231 1..217 752 85.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:30:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13984-PA 599 GL13984-PA 1..199 1..217 750 83.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:30:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30076-PA 576 GA30076-PA 1..199 1..217 765 84.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:30:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12124-PA 339 GM12124-PA 1..214 1..217 819 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:30:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16796-PA 581 GD16796-PA 1..214 1..217 820 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22978-PA 228 GJ22978-PA 1..228 1..217 755 90.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13108-PA 217 GK13108-PA 1..217 1..217 771 89.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:31:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23354-PA 578 GE23354-PA 1..220 1..217 779 98.2 Plus

GH01388.hyp Sequence

Translation from 128 to 781

> GH01388.hyp
MDKMTVAQKNAYLEAHMAVQQQMAQAAIQFKQQQTSQQQNSPTANNNNNS
QNNGNMQQQQQQQQQQQQQQQQQQQQQHYAATIKVPQISSSNVAAAAAGE
STFTVPDDGMGFEGGVRVLQSLGTWSAAEQLTYNIPKPNLIPFTEPYVEG
GSMHPASRLKALQQVQQASSGVRKTNPSKSTNKAFECTVCGKGLARKDKL
TIHMRIHTGEKPYICEV*

GH01388.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG12071-PG 338 CG12071-PG 1..217 1..217 1119 100 Plus
CG12071-PF 338 CG12071-PF 1..217 1..217 1119 100 Plus
CG12071-PE 581 CG12071-PE 1..217 1..217 1119 100 Plus
CG12071-PD 581 CG12071-PD 1..217 1..217 1119 100 Plus
Aef1-PB 308 CG5683-PB 29..216 38..217 182 30.3 Plus