Clone GH01619 Report

Search the DGRC for GH01619

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:16
Well:19
Vector:pOT2
Associated Gene/TranscriptRab2-RA
Protein status:GH01619.pep: gold
Preliminary Size:1223
Sequenced Size:1060

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3269 2001-01-01 Release 2 assignment
CG3269 2003-01-01 Sim4 clustering to Release 3
CG3269 2003-01-14 Blastp of sequenced clone
Rab2 2008-04-29 Release 5.5 accounting
Rab2 2008-08-15 Release 5.9 accounting
Rab2 2008-12-18 5.12 accounting

Clone Sequence Records

GH01619.complete Sequence

1060 bp (1060 high quality bases) assembled on 2003-01-14

GenBank Submission: BT003315

> GH01619.complete
AACAGATTGGAAAACGTACAAGAATTGCGTATTATCTGTGGCATTACGAG
ATCGTACTTTCTAAAAACTAGCTTACCGTAACCCCCGTCAGCTTAAAACA
TGTCCTACGCGTACTTGTTCAAATACATCATTATCGGAGACACAGGCGTG
GGCAAGTCCTGTCTGCTGCTCCAGTTCACGGACAAGCGATTCCAGCCGGT
GCACGACCTGACCATTGGCGTGGAGTTCGGAGCACGCATGATCACCATCG
ACGGCAAGCAGATCAAGCTTCAAATCTGGGACACGGCTGGGCAGGAGGCT
TTCAGATCTATCACACGCTCTTATTACCGCGGAGCTGCTGGCGCCTTGCT
GGTGTACGACATCACGCGACGGGAGACCTTCAACCACCTGACCACCTGGC
TGGAGGATGCGCGTCAGCACTCGAACTCGAACATGGTCATTATGCTGATA
GGCAACAAGAGCGATTTGGATTCGCGGCGTGAGGTGAAGAAAGAGGAGGG
CGAGGCCTTCGCCCGCGAGCACGGACTGGTCTTCATGGAGACTTCTGCGC
GCACAGCTGCCAACGTAGAGGAGGCGTTCATAAATACGGCCAAAGAGATT
TACGAGAAGATCCAGGAAGGTGTCTTCGACATCAACAATGAGGCAAACGG
CATTAAGATCGGCCAACAGCACTCCCCCACAAACCCGTCGCTCCCAGGAG
CCGGAGGAGCAGCTGGAGCAGCAAACAGTGGCTGCTGCTAGGAGTAAACC
GCAGATGCCCGATTGCAATTCTGGGATAGGCGCAGCCGCTTCTGTAAAAG
CTACTTTAGTGACTAACTAATAGAAGGTAGTTGAAGGAACAGATTTCTTG
TTTTCTATCTCAACCGTAACTAACCACGTAAACATAGCTACCACTAATCT
AGCAATTGGACACTAAGCTAAATGTTAAAACCATTAAGATCAGACAGTTA
CAAGAAACACATCTCCTTGTTCAGCTACGTTTTATTTTACCAAAAAAAAC
CAAAAGGAAGAAGTAACCAGAAATAAACCAAAACAAACCACAAAAAAAAA
AAAAAAAAAA

GH01619.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
Rab2-RA 2271 Rab2-RA 139..1180 1..1042 5210 100 Plus
Rab2.e 2256 Rab2.e 64..706 1..643 3215 100 Plus
Rab2.c 2117 Rab2.c 67..567 143..643 2505 100 Plus
Rab2.e 2256 Rab2.e 764..1165 641..1042 2010 100 Plus
Rab2.c 2117 Rab2.c 625..1026 641..1042 2010 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 13:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2585658..2586058 641..1041 2005 100 Plus
chr2R 21145070 chr2R 2585261..2585600 304..643 1700 100 Plus
chr2R 21145070 chr2R 2584627..2584789 143..305 815 100 Plus
chr2R 21145070 chr2R 2583999..2584154 1..156 735 98.1 Plus
chr2L 23010047 chr2L 14356340..14356488 211..359 250 77.9 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
Rab2-RB 642 CG3269-PB 1..642 100..741 3210 100 Plus
Rab2-RA 642 CG3269-PA 1..642 100..741 3210 100 Plus
Rab14-RD 648 CG4212-PD 37..275 121..359 295 74.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:26:22 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:38:19
Subject Length Description Subject Range Query Range Score Percent Strand
Rab2-RB 1087 CG3269-RB 47..1087 1..1041 5205 100 Plus
Rab2-RA 1712 CG3269-RA 47..1087 1..1041 5205 100 Plus
Rab14-RD 878 CG4212-RD 105..343 121..359 295 74.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
Rab2-PB 213 CG3269-PB 1..213 100..738 1050 100 Plus
Rab2-PA 213 CG3269-PA 1..213 100..738 1050 100 Plus
Rab14-PD 215 CG4212-PD 7..198 103..690 640 63.3 Plus
Rab14-PA 215 CG4212-PA 7..198 103..690 640 63.3 Plus
Rab14-PB 239 CG4212-PB 31..222 103..690 640 63.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:38:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6698444..6698845 641..1042 2010 100 Plus
2R 25286936 2R 6698047..6698386 304..643 1700 100 Plus
2R 25286936 2R 6697413..6697575 143..305 815 100 Plus
2R 25286936 2R 6696785..6696940 1..156 735 98.1 Plus
2L 23513712 2L 14357540..14357688 211..359 250 77.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6699643..6700044 641..1042 2010 100 Plus
2R 25260384 2R 6699246..6699585 304..643 1700 100 Plus
2R 25260384 2R 6698612..6698774 143..305 815 100 Plus
2R 25260384 2R 6697984..6698139 1..156 735 98 Plus
2L 23513712 2L 14357579..14357688 250..359 190 78.1 Plus
2L 23513712 2L 14357385..14357450 121..186 180 84.8 Plus
Blast to na_te.dros performed on 2014-11-27 13:38:18 has no hits.

GH01619.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 15:38:26 Download gff for GH01619.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2585660..2586058 643..1041 100   Plus
chr2R 2585263..2585599 306..642 100 -> Plus
chr2R 2584630..2584789 146..305 100 -> Plus
chr2R 2583999..2584143 1..145 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:04:26 Download gff for GH01619.complete
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 1..642 100..741 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:58:02 Download gff for GH01619.complete
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 1..642 100..741 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:44:40 Download gff for GH01619.complete
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 1..642 100..741 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:48:51 Download gff for GH01619.complete
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 1..642 100..741 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:38:26 Download gff for GH01619.complete
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 1..642 100..741 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:14:28 Download gff for GH01619.complete
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 64..1104 1..1041 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:58:02 Download gff for GH01619.complete
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 64..1104 1..1041 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:44:40 Download gff for GH01619.complete
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 47..1087 1..1041 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:48:51 Download gff for GH01619.complete
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 64..1104 1..1041 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:38:26 Download gff for GH01619.complete
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 47..1087 1..1041 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:38:26 Download gff for GH01619.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6698446..6698844 643..1041 100   Plus
2R 6698049..6698385 306..642 100 -> Plus
2R 6697416..6697575 146..305 100 -> Plus
2R 6696785..6696929 1..145 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:44:40 Download gff for GH01619.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2585951..2586349 643..1041 100   Plus
arm_2R 2585554..2585890 306..642 100 -> Plus
arm_2R 2584921..2585080 146..305 100 -> Plus
arm_2R 2584290..2584434 1..145 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:20:16 Download gff for GH01619.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6699645..6700043 643..1041 100   Plus
2R 6699248..6699584 306..642 100 -> Plus
2R 6698615..6698774 146..305 100 -> Plus
2R 6697984..6698128 1..145 100 -> Plus

GH01619.pep Sequence

Translation from 99 to 740

> GH01619.pep
MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITI
DGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTW
LEDARQHSNSNMVIMLIGNKSDLDSRREVKKEEGEAFAREHGLVFMETSA
RTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGQQHSPTNPSLPG
AGGAAGAANSGCC*

GH01619.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 22:58:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11067-PA 213 GF11067-PA 1..213 1..213 1144 100 Plus
Dana\GF14883-PA 239 GF14883-PA 31..237 2..212 674 60.2 Plus
Dana\GF11646-PA 213 GF11646-PA 4..190 2..188 562 56.1 Plus
Dana\GF20241-PA 204 GF20241-PA 5..173 2..170 485 50.9 Plus
Dana\GF17263-PA 205 GF17263-PA 8..205 3..213 483 46 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 22:58:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23219-PA 213 GG23219-PA 1..213 1..213 1144 100 Plus
Dere\GG21802-PA 213 GG21802-PA 4..190 2..188 562 56.1 Plus
Dere\GG14761-PA 205 GG14761-PA 8..205 3..213 484 46 Plus
Dere\GG13365-PA 207 GG13365-PA 4..193 2..195 482 46.4 Plus
Dere\GG24366-PA 214 GG24366-PA 8..178 3..173 481 54.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 22:58:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21751-PA 213 GH21751-PA 1..213 1..213 1117 97.2 Plus
Dgri\GH11344-PA 243 GH11344-PA 35..241 2..212 672 60.2 Plus
Dgri\GH20926-PA 213 GH20926-PA 4..190 2..188 562 56.1 Plus
Dgri\GH18257-PA 214 GH18257-PA 8..178 3..173 481 54.4 Plus
Dgri\GH18937-PA 205 GH18937-PA 8..205 3..213 479 46 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 22:58:17
Subject Length Description Subject Range Query Range Score Percent Strand
Rab2-PB 213 CG3269-PB 1..213 1..213 1103 100 Plus
Rab2-PA 213 CG3269-PA 1..213 1..213 1103 100 Plus
Rab14-PD 215 CG4212-PD 7..213 2..212 648 60.2 Plus
Rab14-PA 215 CG4212-PA 7..213 2..212 648 60.2 Plus
Rab14-PB 239 CG4212-PB 31..237 2..212 648 60.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 22:58:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19298-PA 213 GI19298-PA 1..213 1..213 1079 97.7 Plus
Dmoj\GI12880-PA 243 GI12880-PA 35..241 2..212 682 60.7 Plus
Dmoj\GI18364-PA 213 GI18364-PA 4..190 2..188 561 56.1 Plus
Dmoj\GI10837-PA 205 GI10837-PA 8..205 3..213 484 46 Plus
Dmoj\GI23656-PA 214 GI23656-PA 8..178 3..173 481 54.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 22:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11116-PA 213 GL11116-PA 1..213 1..213 1142 99.5 Plus
Dper\GL21269-PA 239 GL21269-PA 31..237 2..212 668 59.2 Plus
Dper\GL11470-PA 213 GL11470-PA 4..190 2..188 562 56.1 Plus
Dper\GL27164-PA 205 GL27164-PA 8..205 3..213 492 46.4 Plus
Dper\GL14723-PA 218 GL14723-PA 6..218 3..213 483 48.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 22:58:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17076-PA 213 GA17076-PA 1..213 1..213 1142 99.5 Plus
Dpse\GA18036-PA 239 GA18036-PA 31..237 2..212 668 59.2 Plus
Dpse\GA18527-PA 213 GA18527-PA 4..190 2..188 562 56.1 Plus
Dpse\GA17362-PA 205 GA17362-PA 8..205 3..213 492 46.4 Plus
Dpse\GA11442-PA 218 GA11442-PA 6..218 3..213 483 48.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 22:58:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20894-PA 200 GM20894-PA 1..188 1..193 967 94.8 Plus
Dsec\GM15560-PA 239 GM15560-PA 31..237 2..212 674 60.2 Plus
Dsec\GM21805-PA 213 GM21805-PA 4..190 2..188 562 56.1 Plus
Dsec\GM15089-PA 205 GM15089-PA 8..205 3..213 484 46 Plus
Dsec\GM15893-PA 207 GM15893-PA 4..193 2..195 482 46.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 22:58:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10420-PA 213 GD10420-PA 1..213 1..213 1144 100 Plus
Dsim\GD23961-PA 239 GD23961-PA 31..237 2..212 667 59.7 Plus
Dsim\GD11294-PA 213 GD11294-PA 4..190 2..188 562 56.1 Plus
Dsim\GD19996-PA 205 GD19996-PA 8..205 3..213 484 46 Plus
Dsim\GD12244-PA 207 GD12244-PA 4..193 2..195 482 46.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 22:58:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22175-PA 213 GJ22175-PA 1..213 1..213 1117 97.2 Plus
Dvir\GJ18183-PA 236 GJ18183-PA 28..234 2..212 683 60.7 Plus
Dvir\GJ21435-PA 213 GJ21435-PA 4..190 2..188 559 56.1 Plus
Dvir\GJ14443-PA 205 GJ14443-PA 8..205 3..213 485 46 Plus
Dvir\GJ15895-PA 218 GJ15895-PA 6..196 3..188 482 51.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 22:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23088-PA 213 GK23088-PA 1..213 1..213 1142 99.5 Plus
Dwil\GK18273-PA 243 GK18273-PA 35..241 2..212 669 59.7 Plus
Dwil\GK10719-PA 213 GK10719-PA 4..190 2..188 557 55.6 Plus
Dwil\GK12772-PA 205 GK12772-PA 8..205 3..213 484 46 Plus
Dwil\GK17214-PA 207 GK17214-PA 4..185 2..184 479 48.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 22:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19072-PA 213 GE19072-PA 1..213 1..213 1144 100 Plus
Dyak\GE19031-PA 239 GE19031-PA 31..237 2..212 674 60.2 Plus
Dyak\GE11879-PA 213 GE11879-PA 4..190 2..188 562 56.1 Plus
Dyak\Rab1-PA 205 GE25003-PA 8..205 3..213 484 46 Plus
Dyak\GE22459-PA 207 GE22459-PA 4..193 2..195 482 46.4 Plus

GH01619.hyp Sequence

Translation from 99 to 740

> GH01619.hyp
MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITI
DGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTW
LEDARQHSNSNMVIMLIGNKSDLDSRREVKKEEGEAFAREHGLVFMETSA
RTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGQQHSPTNPSLPG
AGGAAGAANSGCC*

GH01619.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:20:26
Subject Length Description Subject Range Query Range Score Percent Strand
Rab2-PB 213 CG3269-PB 1..213 1..213 1103 100 Plus
Rab2-PA 213 CG3269-PA 1..213 1..213 1103 100 Plus
Rab14-PD 215 CG4212-PD 7..213 2..212 648 60.2 Plus
Rab14-PA 215 CG4212-PA 7..213 2..212 648 60.2 Plus
Rab14-PB 239 CG4212-PB 31..237 2..212 648 60.2 Plus