Clone GH01842 Report

Search the DGRC for GH01842

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:18
Well:42
Vector:pOT2
Associated Gene/TranscriptE(spl)mbeta-HLH-RA
Protein status:GH01842.pep: gold
Preliminary Size:1169
Sequenced Size:975

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14548 2001-01-01 Release 2 assignment
CG14548 2002-05-17 Blastp of sequenced clone
CG14548 2003-01-01 Sim4 clustering to Release 3
HLHmbeta 2008-04-29 Release 5.5 accounting
HLHmbeta 2008-08-15 Release 5.9 accounting
HLHmbeta 2008-12-18 5.12 accounting

Clone Sequence Records

GH01842.complete Sequence

975 bp (975 high quality bases) assembled on 2002-05-17

GenBank Submission: AY118723

> GH01842.complete
TGCACACAGAGTCTCCGAGTCCGAATCTAGTGGAACGTTGCGACTGTGGA
TTACGCGAGTTTACTTTACCCCCAATAAAAAAAAAAAACAAAACCAAACT
ACAACAAAATGGTTCTGGAAATGGAGATGTCCAAGACCTATCAGTACCGC
AAGGTGATGAAGCCCATGCTGGAGCGTAAGCGCCGTGCCAGGATTAACAA
GTGCCTGGACGAGCTCAAGGACATCATGGTGGAGTGCCTGACCCAGGAGG
GCGAGCACATCACCCGGCTGGAGAAGGCCGACATCCTGGAGCTGACCGTG
GAGCACATGAAGAAGCTGCGTGCCCAGAAGCAGCTGCGTCTGTCCAGCGT
CACCGGTGGAGTGTCTCCGAGTGCCGATCCCAAGCTTAGCATCGCTGAGA
GTTTCCGTGCTGGCTACGTTCATGCTGCCAATGAAGTGTCCAAAACCTTG
GCCGCTGTACCCGGAGTGAGTGTGGATCTCGGCACCCAGCTGATGAGTCA
CCTTGGCCATCGTCTCAACTACCTGCAAGTGGTGGTTCCCTCGCTGCCCA
TTGGAGTGCCTCTTCAAGCTCCAGTAGAGGATCAAGCTATGGTCACTCCA
CCTCCCTCGGAATGCGACAGCTTGGAGAGCGGAGCCTGCAGCCCGGCGCC
CAGCGAGGCCAGCTCCACCTCTGGCCCCATGTGGCGTCCCTGGTGATCAA
CTGGACTCCGGATGATATTCACCTGAATCGCCTTCAAGCGGAAGGCTTCT
ACAAATTTGTTGCCCCAAAGAGGTGCTGGACTTGAAACCGCACCGAACTC
CTTGGAGATCATCAATTGCTGCCCAGGAATAGCTTTCCCAGCAGCCCAGC
AGAGCCACCGATCATCTCTAGCAGAGCCTCAAATTTCGGCTATAGAGATG
GCTGCTGCTCACTTCTTAAAGTCATAAAGAAATGAAAATAAATGAAATTC
CAACTCAAAAAAAAAAAAAAAAAAA

GH01842.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
HLHmbeta-RA 1098 HLHmbeta-RA 25..980 1..958 4735 99.7 Plus
HLHm3-RA 1422 HLHm3-RA 312..505 121..314 640 88.6 Plus
HLHmgamma-RA 904 HLHmgamma-RA 107..204 124..221 400 93.8 Plus
HLHmgamma-RA 904 HLHmgamma-RA 230..282 247..299 160 86.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:00:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21828032..21828985 956..1 4700 99.7 Minus
chr3R 27901430 chr3R 21845013..21845206 121..314 625 88.1 Plus
chr3R 27901430 chr3R 21822953..21823128 124..299 460 84.1 Plus
chr3R 27901430 chr3R 21860162..21860275 124..237 405 90.4 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:00:54
Subject Length Description Subject Range Query Range Score Percent Strand
E(spl)mbeta-HLH-RA 588 CG14548-PA 1..588 109..696 2940 100 Plus
E(spl)m3-HLH-RA 675 CG8346-PA 7..200 121..314 640 88.7 Plus
E(spl)mgamma-HLH-RA 618 CG8333-PA 22..197 124..299 460 84.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:26:52 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:00:53
Subject Length Description Subject Range Query Range Score Percent Strand
E(spl)mbeta-HLH-RA 978 CG14548-RA 25..978 1..956 4715 99.8 Plus
E(spl)m3-HLH-RA 1305 CG8346-RA 204..397 121..314 640 88.7 Plus
E(spl)mgamma-HLH-RA 911 CG8333-RA 114..289 124..299 460 84.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:00:57
Subject Length Description Subject Range Query Range Score Percent Strand
E(spl)mbeta-HLH-PA 195 CG14548-PA 1..195 109..693 999 100 Plus
E(spl)mgamma-HLH-PA 205 CG8333-PA 8..205 124..693 475 50.5 Plus
E(spl)m3-HLH-PA 224 CG8346-PA 3..224 121..693 422 45.5 Plus
E(spl)m7-HLH-PA 186 CG8361-PA 1..186 109..693 412 46.3 Plus
E(spl)mdelta-HLH-PA 173 CG8328-PA 9..173 127..693 308 40 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26005044..26005999 958..1 4725 99.8 Minus
3R 32079331 3R 26022026..26022219 121..314 640 88.7 Plus
3R 32079331 3R 25999964..26000139 124..299 460 84.1 Plus
3R 32079331 3R 26037178..26037291 124..237 405 90.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25745875..25746830 958..1 4735 99.7 Minus
3R 31820162 3R 25762857..25763050 121..314 640 88.6 Plus
3R 31820162 3R 25778009..25778122 124..237 405 90.3 Plus
3R 31820162 3R 25740795..25740892 124..221 400 93.8 Plus
3R 31820162 3R 25740918..25740970 247..299 160 86.7 Plus
3R 31820162 3R 25738587..25738693 127..233 160 76.6 Plus
Blast to na_te.dros performed on 2014-11-27 09:00:52 has no hits.

GH01842.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:36:11 Download gff for GH01842.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21828032..21828985 1..956 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:05:22 Download gff for GH01842.complete
Subject Subject Range Query Range Percent Splice Strand
HLHmbeta-RA 1..588 109..696 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:49:43 Download gff for GH01842.complete
Subject Subject Range Query Range Percent Splice Strand
HLHmbeta-RA 1..588 109..696 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:27:01 Download gff for GH01842.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)mbeta-HLH-RA 1..588 109..696 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:42:19 Download gff for GH01842.complete
Subject Subject Range Query Range Percent Splice Strand
HLHmbeta-RA 1..588 109..696 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:36:11 Download gff for GH01842.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)mbeta-HLH-RA 1..588 109..696 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:26:47 Download gff for GH01842.complete
Subject Subject Range Query Range Percent Splice Strand
HLHmbeta-RA 25..978 1..956 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:49:43 Download gff for GH01842.complete
Subject Subject Range Query Range Percent Splice Strand
HLHmbeta-RA 25..978 1..956 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:27:01 Download gff for GH01842.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)mbeta-HLH-RA 25..978 1..956 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:42:19 Download gff for GH01842.complete
Subject Subject Range Query Range Percent Splice Strand
HLHmbeta-RA 25..978 1..956 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:36:11 Download gff for GH01842.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)mbeta-HLH-RA 25..978 1..956 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:36:11 Download gff for GH01842.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26005046..26005999 1..956 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:27:01 Download gff for GH01842.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21830768..21831721 1..956 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:14:37 Download gff for GH01842.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25745877..25746830 1..956 99   Minus

GH01842.hyp Sequence

Translation from 1 to 695

> GH01842.hyp
AHRVSESESSGTLRLWITRVYFTPNKKKTKPNYNKMVLEMEMSKTYQYRK
VMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVE
HMKKLRAQKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLA
AVPGVSVDLGTQLMSHLGHRLNYLQVVVPSLPIGVPLQAPVEDQAMVTPP
PSECDSLESGACSPAPSEASSTSGPMWRPW*

GH01842.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:22:33
Subject Length Description Subject Range Query Range Score Percent Strand
E(spl)mbeta-HLH-PA 195 CG14548-PA 1..195 36..230 999 100 Plus
E(spl)mgamma-HLH-PA 205 CG8333-PA 8..205 41..230 475 50.5 Plus
E(spl)m3-HLH-PA 224 CG8346-PA 3..224 40..230 422 45.5 Plus
E(spl)m7-HLH-PA 186 CG8361-PA 1..186 36..230 412 46.3 Plus
E(spl)mdelta-HLH-PA 173 CG8328-PA 9..173 42..230 308 40 Plus

GH01842.pep Sequence

Translation from 108 to 695

> GH01842.pep
MVLEMEMSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEH
ITRLEKADILELTVEHMKKLRAQKQLRLSSVTGGVSPSADPKLSIAESFR
AGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLNYLQVVVPSLPIGV
PLQAPVEDQAMVTPPPSECDSLESGACSPAPSEASSTSGPMWRPW*

GH01842.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 20:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18225-PA 200 GF18225-PA 1..196 1..195 919 91 Plus
Dana\GF16796-PA 205 GF16796-PA 11..205 9..195 473 49.3 Plus
Dana\GF16799-PA 224 GF16799-PA 3..135 5..136 416 61.9 Plus
Dana\GF16801-PA 180 GF16801-PA 1..180 1..195 406 48.2 Plus
Dana\GF16795-PA 182 GF16795-PA 9..182 7..195 335 40.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 20:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12207-PA 195 GG12207-PA 1..195 1..195 1016 99 Plus
Dere\GG11450-PA 205 GG11450-PA 8..205 6..195 483 49.5 Plus
Dere\GG11454-PA 226 GG11454-PA 3..226 5..195 424 45.3 Plus
Dere\GG11458-PA 186 GG11458-PA 1..124 1..140 401 57.9 Plus
Dere\GG11449-PA 173 GG11449-PA 9..173 7..195 327 39.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 20:09:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18148-PA 210 GH18148-PA 1..210 1..195 834 80.7 Plus
Dgri\GH19452-PA 217 GH19452-PA 11..182 9..189 484 54.9 Plus
Dgri\GH19456-PA 228 GH19456-PA 3..136 5..136 399 59 Plus
Dgri\GH19458-PA 207 GH19458-PA 1..207 1..195 397 40.4 Plus
Dgri\GH19451-PA 198 GH19451-PA 9..198 7..195 335 39 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 20:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
E(spl)mbeta-HLH-PA 195 CG14548-PA 1..195 1..195 999 100 Plus
E(spl)mgamma-HLH-PA 205 CG8333-PA 8..205 6..195 475 50.5 Plus
E(spl)m3-HLH-PA 224 CG8346-PA 3..224 5..195 422 45.5 Plus
E(spl)m7-HLH-PA 186 CG8361-PA 1..186 1..195 412 46.3 Plus
E(spl)mdelta-HLH-PA 173 CG8328-PA 9..173 7..195 308 40 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 20:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22910-PA 210 GI22910-PA 1..210 1..195 826 81.5 Plus
Dmoj\GI24686-PA 217 GI24686-PA 8..182 6..189 488 55.7 Plus
Dmoj\GI24690-PA 229 GI24690-PA 3..138 5..136 409 59.9 Plus
Dmoj\GI24692-PA 207 GI24692-PA 1..207 1..195 389 40.9 Plus
Dmoj\GI24685-PA 185 GI24685-PA 9..185 7..195 338 41.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 20:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22021-PA 200 GL22021-PA 1..200 1..195 888 89.5 Plus
Dper\GL21815-PA 214 GL21815-PA 8..178 6..186 504 58.2 Plus
Dper\GL21819-PA 225 GL21819-PA 3..133 5..136 414 60.6 Plus
Dper\GL21822-PA 207 GL21822-PA 1..207 1..195 378 41.1 Plus
Dper\GL21813-PA 188 GL21813-PA 9..188 7..195 331 41.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 20:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13073-PA 200 GA13073-PA 1..200 1..195 888 89.5 Plus
Dpse\GA20996-PA 214 GA20996-PA 8..178 6..186 502 57.7 Plus
Dpse\GA21008-PA 219 GA21008-PA 3..219 5..195 415 45.9 Plus
Dpse\GA21018-PA 206 GA21018-PA 1..206 1..195 371 40.2 Plus
Dpse\GA20991-PA 188 GA20991-PA 9..188 7..195 331 41.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 20:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10206-PA 195 GM10206-PA 1..195 1..195 1010 97.9 Plus
Dsec\GM10294-PA 205 GM10294-PA 8..205 6..195 486 49.5 Plus
Dsec\GM10297-PA 221 GM10297-PA 3..221 5..195 429 46.4 Plus
Dsec\GM10299-PA 186 GM10299-PA 1..186 1..195 400 46.5 Plus
Dsec\GM10293-PA 173 GM10293-PA 9..173 7..195 326 40.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 20:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\HLHmbeta-PA 195 GD18157-PA 1..195 1..195 1016 99 Plus
Dsim\HLHmgamma-PA 205 GD21258-PA 8..205 6..195 486 49.5 Plus
Dsim\HLHm3-PA 224 GD21261-PA 3..224 5..195 426 45.7 Plus
Dsim\HLHm7-PA 186 GD21263-PA 1..186 1..195 403 45.8 Plus
Dsim\HLHmdelta-PA 173 GD21257-PA 9..173 7..195 326 40.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 20:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23323-PA 209 GJ23323-PA 1..209 1..195 837 81.5 Plus
Dvir\GJ23903-PA 217 GJ23903-PA 8..182 6..189 487 56.2 Plus
Dvir\GJ23906-PA 220 GJ23906-PA 3..136 5..136 415 62.2 Plus
Dvir\GJ23909-PA 197 GJ23909-PA 1..197 1..195 398 44.3 Plus
Dvir\GJ23902-PA 188 GJ23902-PA 9..188 7..195 354 40.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 20:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12809-PA 201 GK12809-PA 1..201 1..195 751 77.6 Plus
Dwil\GK14455-PA 209 GK14455-PA 8..209 6..195 502 52.4 Plus
Dwil\GK14459-PA 200 GK14459-PA 1..146 1..159 421 55 Plus
Dwil\GK14458-PA 223 GK14458-PA 3..133 5..136 410 59.1 Plus
Dwil\GK14454-PA 184 GK14454-PA 9..184 7..195 350 42.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 20:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\HLHmbeta-PA 195 GE10652-PA 1..195 1..195 1007 97.9 Plus
Dyak\HLHmgamma-PA 205 GE23644-PA 8..205 6..195 482 49 Plus
Dyak\GE23647-PA 224 GE23647-PA 3..224 5..195 426 45.7 Plus
Dyak\HLHm7-PA 186 GE23649-PA 1..124 1..140 401 57.9 Plus
Dyak\HLHmdelta-PA 173 GE23643-PA 9..173 7..195 324 40.1 Plus