Clone GH01941 Report

Search the DGRC for GH01941

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:19
Well:41
Vector:pOT2
Associated Gene/Transcriptcalypso-RA
Protein status:GH01941.pep: gold
Preliminary Size:1743
Sequenced Size:2148

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8445 2001-01-01 Release 2 assignment
CG8445 2001-07-04 Blastp of sequenced clone
CG8445 2003-01-01 Sim4 clustering to Release 3
CG8445 2008-04-29 Release 5.5 accounting
CG8445 2008-08-15 Release 5.9 accounting
CG8445 2008-12-18 5.12 accounting

Clone Sequence Records

GH01941.complete Sequence

2148 bp (2148 high quality bases) assembled on 2001-07-04

GenBank Submission: AY047515

> GH01941.complete
CTAAGGCAGATAAGAGGAAGCGCAAAAAACTATTTTGGTCCAAATCGGTA
ATATTTTTATATTTAAAATGAATTGGGGACAGAAGATAACCGGCAGCCGA
CGGCCCTAACTTCTGGACGGACATCGCCAGTATATGGATTGCTCCTAAAA
CTAGCAAACCAACGTACTTATGCTCTATGCAACAATAAATGTCATATGAA
AACAAACTATTGAAGACGTTTTTATGAGTATAACCGATTTTCATGTGTAT
ATCCTTCTCTGTGCAGAAAAACGAAATTAAAGTAACATCTCGGATACTTT
CGCAGCAATTGTATAAGCCATACAAATATGAACGCTGCTGGAGGAGGTAG
TGGTGCCCAGGCGGCCGCAGTGGCGGCAGGCAACAACAGTCTCAGCCACA
ATGCGCTACTTTCCACGGCCTCAGGAGCCACCACCATGCCTATGGCCCAA
CTGGCAGACGGTTGGTTGGAGCTGGAGTCCGACCCAGGTCTCTTCACACT
GCTTCTCAAGGATTTTGGATGTCACGATGTACAGGTGGAGGAGGTGTACG
ACCTACAGAAACCCATCGAGAGTCCATATGGCTTCATATTTCTCTTCCGC
TGGATCGAAGAGCGACGCGCCAGACGCAAAATTGTGGAGACAACTGCTGA
GATATTCGTCAAGGATGAGGAGGCCATTTCCAGCATTTTCTTCGCCCAGC
AGGTAGTCCCCAATAGCTGTGCCACACACGCGTTGCTTTCGGTGCTCCTG
AACTGCAACGAGAACAATCTTCAGCTGGGCGACACCCTGAGTCGACTAAA
AACCCACACCAAAGGCATGAGTCCGGAGAACAAGGGGCTGGCTATTGGCA
ACACTCCGGAGCTGGCCTGTGCCCATAACTCACACGCAATGCCGCAGGCT
CGGCGCCGTCTAGAAAGGACGGGAGCGGGCGTCTCAAGTTGCCGCTTCAC
GGGTGAGGCGTTTCACTTCGTTAGCTTTGTGCCTATCAATGGACAACTGT
TTGAGCTGGATGGCTTGAAACCGTATCCCATGAATCACGGCGGTTGGGAG
GATAGCGAGGATTGGACAGATAAGTTCCGACGTGTGATGGCTGAGCGACT
GGGAATAGCGACCGGCGAACAGGACATACGTTTCAATCTCATGGCCGTAG
TGCCAGACAGGCGGATTGCCATAACACATAAACTTAAGATGCTGCGCACA
AACCAGGCAATCGTGTCCGGAACACTGCAGAAACTTCTAAAGGCCGACGA
GCAGGGCGAATCGGGGAACGGAGACTCACAACGTCCGGATACACCCACCA
CATTATTGGAGCCGAGCGCTTTCACCGCACGTGACCTGCAATCGCTTCTC
AAGAACCTGGACACAGAAATAGCCATCAATGAGCAGCATCTGGCTGACGA
AAACGATCGGAGGCACATGTTTAAGGTGGACGCCAGTCGACGTACCCACA
ACTACGATAAGTTCATTTGCACTTTCCTCTCTATGCTGGCCCACCAGGGC
GTCCTGGGCGAGCTGGTTAGCCAGCATTTGCTTCCGTCGAAGAAGGTCAG
TGGCCAGGGTGCTGCCAATCGGATCAGCAAGCAGAGCACCACCGCCAGTG
CAGGCGGAAGCACCGCAGCAGGCACTGCATCCACGCCCAAGACTCAGCAA
CAGCAGGCTGCGGCCGCTAAGAATGGCAAGTCGCCAAGCAAAACGCCAGG
CAGGAGGCGAAAGGGACGCAACAAGTGCAGAAAACGGAAGTAGGCGACCA
GACGACCAGCATGTACATGTTTTTAAGAATACAGTTTGCATTTTTAAGAC
CATTCATTCCAGTATTGTTTTTCTACAATTTCCCCACCAAGAAGCACCAT
TAACCCATAAGATCGTATAAGTTTAGTTTTAGTAACACTCAATGCGGTTC
TTTTAAATACGAAATCAACTTGGCAGCTTCATTTTTATTTGATCGCAATT
CGATCTTTTTAATAATAAAAAACCATTTTGTTCGTATGAATCGTTTTTCA
TGTGGTCCTTGATAGACGAAGGACCCAAATGTGTATGCATTACATATGAA
TAATATATATATTTTCTGATATATATCTATATGATAGTTGTATAACAAAA
ACGTAATCCTTCAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH01941.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:35:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG8445-RA 2124 CG8445-RA 4..2121 1..2117 10550 99.9 Plus
CG8445-RB 2094 CG8445-RB 239..2091 266..2117 9225 99.9 Plus
CG8445-RB 2094 CG8445-RB 4..240 1..237 1185 100 Plus
CG8443.a 5407 CG8443.a 5195..5407 2117..1905 1065 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12081384..12082979 2115..521 7930 99.9 Minus
chr2R 21145070 chr2R 12083037..12083323 522..236 1435 100 Minus
chr2R 21145070 chr2R 12083389..12083624 236..1 1180 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
calypso-RA 1416 CG8445-PA 1..1416 328..1743 7080 100 Plus
calypso-RB 1416 CG8445-PB 1..1416 328..1743 7080 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:27:06 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
calypso-RA 2147 CG8445-RA 32..2147 1..2115 10530 100 Plus
calypso-RB 2117 CG8445-RB 267..2117 266..2115 9205 99.9 Plus
calypso-RB 2117 CG8445-RB 32..268 1..237 1185 100 Plus
clu-RB 5609 CG8443-RB 5394..5609 2115..1900 1080 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
calypso-PA 471 CG8445-PA 19..458 382..1701 2132 100 Plus
calypso-PB 471 CG8445-PB 19..458 382..1701 2132 100 Plus
Uch-L5-PB 324 CG3431-PB 1..300 442..1506 444 31.9 Plus
Uch-L5-PA 324 CG3431-PA 1..300 442..1506 444 31.9 Plus
Uch-L5R-PA 340 CG1950-PA 15..314 433..1506 433 30.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:15:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16194060..16195657 2117..521 7940 99.9 Minus
2R 25286936 2R 16195715..16196001 522..236 1435 100 Minus
2R 25286936 2R 16196067..16196302 236..1 1180 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:56:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16195259..16196856 2117..521 7950 99.9 Minus
2R 25260384 2R 16196914..16197200 522..236 1435 100 Minus
2R 25260384 2R 16197266..16197501 236..1 1180 100 Minus
Blast to na_te.dros performed on 2014-11-27 04:15:50 has no hits.

GH01941.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:28:00 Download gff for GH01941.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12083389..12083624 1..236 100   Minus
chr2R 12083039..12083322 237..520 100 <- Minus
chr2R 12081384..12082979 521..2115 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:06:00 Download gff for GH01941.complete
Subject Subject Range Query Range Percent Splice Strand
CG8445-RB 1..1416 328..1743 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:25:15 Download gff for GH01941.complete
Subject Subject Range Query Range Percent Splice Strand
calypso-RA 1..1416 328..1743 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:15:42 Download gff for GH01941.complete
Subject Subject Range Query Range Percent Splice Strand
calypso-RB 1..1416 328..1743 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:58:14 Download gff for GH01941.complete
Subject Subject Range Query Range Percent Splice Strand
CG8445-RB 1..1416 328..1743 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:28:00 Download gff for GH01941.complete
Subject Subject Range Query Range Percent Splice Strand
calypso-RB 1..1416 328..1743 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:23:42 Download gff for GH01941.complete
Subject Subject Range Query Range Percent Splice Strand
CG8445-RA 1..2116 1..2115 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:25:15 Download gff for GH01941.complete
Subject Subject Range Query Range Percent Splice Strand
calypso-RA 1..2116 1..2115 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:15:42 Download gff for GH01941.complete
Subject Subject Range Query Range Percent Splice Strand
calypso-RA 32..2147 1..2115 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:58:15 Download gff for GH01941.complete
Subject Subject Range Query Range Percent Splice Strand
CG8445-RA 1..2116 1..2115 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:28:00 Download gff for GH01941.complete
Subject Subject Range Query Range Percent Splice Strand
calypso-RA 32..2147 1..2115 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:28:00 Download gff for GH01941.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16196067..16196302 1..236 100   Minus
2R 16195717..16196000 237..520 100 <- Minus
2R 16194062..16195657 521..2115 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:15:42 Download gff for GH01941.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12083572..12083807 1..236 100   Minus
arm_2R 12083222..12083505 237..520 100 <- Minus
arm_2R 12081567..12083162 521..2115 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:36:02 Download gff for GH01941.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16197266..16197501 1..236 100   Minus
2R 16196916..16197199 237..520 100 <- Minus
2R 16195261..16196856 521..2115 99 <- Minus

GH01941.pep Sequence

Translation from 327 to 1742

> GH01941.pep
MNAAGGGSGAQAAAVAAGNNSLSHNALLSTASGATTMPMAQLADGWLELE
SDPGLFTLLLKDFGCHDVQVEEVYDLQKPIESPYGFIFLFRWIEERRARR
KIVETTAEIFVKDEEAISSIFFAQQVVPNSCATHALLSVLLNCNENNLQL
GDTLSRLKTHTKGMSPENKGLAIGNTPELACAHNSHAMPQARRRLERTGA
GVSSCRFTGEAFHFVSFVPINGQLFELDGLKPYPMNHGGWEDSEDWTDKF
RRVMAERLGIATGEQDIRFNLMAVVPDRRIAITHKLKMLRTNQAIVSGTL
QKLLKADEQGESGNGDSQRPDTPTTLLEPSAFTARDLQSLLKNLDTEIAI
NEQHLADENDRRHMFKVDASRRTHNYDKFICTFLSMLAHQGVLGELVSQH
LLPSKKVSGQGAANRISKQSTTASAGGSTAAGTASTPKTQQQQAAAAKNG
KSPSKTPGRRRKGRNKCRKRK*

GH01941.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12763-PA 470 GF12763-PA 19..470 21..471 2175 91.8 Plus
Dana\GF24661-PA 324 GF24661-PA 1..323 39..424 462 32.4 Plus
Dana\GF19511-PA 413 GF19511-PA 23..317 43..393 412 29.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:34:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22294-PA 471 GG22294-PA 22..471 22..471 2360 98.7 Plus
Dere\GG14033-PA 324 GG14033-PA 1..314 39..415 459 32.2 Plus
Dere\GG19562-PA 335 GG19562-PA 14..307 43..393 361 29.7 Plus
Dere\GG24548-PA 227 GG24548-PA 4..222 46..274 154 26.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22997-PA 462 GH22997-PA 2..462 3..471 2059 82.6 Plus
Dgri\GH16209-PA 324 GH16209-PA 1..323 39..424 467 32.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:34:40
Subject Length Description Subject Range Query Range Score Percent Strand
calypso-PA 471 CG8445-PA 1..471 1..471 2429 100 Plus
calypso-PB 471 CG8445-PB 1..471 1..471 2429 100 Plus
Uch-L5-PB 324 CG3431-PB 1..300 39..393 444 31.9 Plus
Uch-L5-PA 324 CG3431-PA 1..300 39..393 444 31.9 Plus
Uch-L5R-PA 340 CG1950-PA 15..314 36..393 433 30.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:34:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18963-PA 461 GI18963-PA 21..461 37..471 2077 88.1 Plus
Dmoj\GI13355-PA 324 GI13355-PA 1..319 39..420 471 32 Plus
Dmoj\GI16929-PA 229 GI16929-PA 4..224 46..274 157 26.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10684-PA 475 GL10684-PA 1..475 1..471 2232 89.5 Plus
Dper\GL17965-PA 324 GL17965-PA 1..323 39..424 462 32.2 Plus
Dper\GL20225-PA 351 GL20225-PA 25..330 45..399 425 29.4 Plus
Dper\GL19416-PA 227 GL19416-PA 4..222 46..274 156 27.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:34:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21084-PA 475 GA21084-PA 1..475 1..471 2232 89.5 Plus
Dpse\GA17448-PA 324 GA17448-PA 1..323 39..424 462 32.2 Plus
Dpse\GA26899-PA 351 GA26899-PA 25..346 45..415 429 28.6 Plus
Dpse\GA18067-PA 227 GA18067-PA 4..222 46..274 155 27.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:34:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20083-PA 471 GM20083-PA 1..471 1..471 2493 98.3 Plus
Dsec\GM24867-PA 324 GM24867-PA 1..314 39..415 465 31.7 Plus
Dsec\GM13220-PA 340 GM13220-PA 15..314 30..393 432 31.2 Plus
Dsec\GM18256-PA 227 GM18256-PA 4..222 46..274 154 26.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:34:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25561-PA 471 GD25561-PA 1..471 1..471 2496 98.3 Plus
Dsim\GD12919-PA 324 GD12919-PA 1..314 39..415 467 32.6 Plus
Dsim\GD15942-PA 426 GD15942-PA 101..400 30..393 419 29.5 Plus
Dsim\GD22865-PA 227 GD22865-PA 4..222 46..274 152 26.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:34:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20906-PA 462 GJ20906-PA 20..462 36..471 2077 88.1 Plus
Dvir\GJ13185-PA 325 GJ13185-PA 1..324 39..424 452 32.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22163-PA 435 GK22163-PA 1..435 37..471 2173 93.3 Plus
Dwil\GK22136-PA 147 GK22136-PA 1..145 1..133 495 70.3 Plus
Dwil\GK20334-PA 324 GK20334-PA 1..323 39..424 467 31.2 Plus
Dwil\GK16481-PA 376 GK16481-PA 27..333 43..393 416 31.5 Plus
Dwil\GK15133-PA 227 GK15133-PA 4..222 46..274 154 26.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:34:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14091-PA 471 GE14091-PA 19..471 19..471 2376 98.9 Plus
Dyak\GE21236-PA 324 GE21236-PA 1..314 39..415 458 32.5 Plus
Dyak\GE16722-PA 329 GE16722-PA 18..307 46..393 392 30.6 Plus
Dyak\GE15202-PA 227 GE15202-PA 4..222 46..274 152 26.8 Plus

GH01941.hyp Sequence

Translation from 327 to 1742

> GH01941.hyp
MNAAGGGSGAQAAAVAAGNNSLSHNALLSTASGATTMPMAQLADGWLELE
SDPGLFTLLLKDFGCHDVQVEEVYDLQKPIESPYGFIFLFRWIEERRARR
KIVETTAEIFVKDEEAISSIFFAQQVVPNSCATHALLSVLLNCNENNLQL
GDTLSRLKTHTKGMSPENKGLAIGNTPELACAHNSHAMPQARRRLERTGA
GVSSCRFTGEAFHFVSFVPINGQLFELDGLKPYPMNHGGWEDSEDWTDKF
RRVMAERLGIATGEQDIRFNLMAVVPDRRIAITHKLKMLRTNQAIVSGTL
QKLLKADEQGESGNGDSQRPDTPTTLLEPSAFTARDLQSLLKNLDTEIAI
NEQHLADENDRRHMFKVDASRRTHNYDKFICTFLSMLAHQGVLGELVSQH
LLPSKKVSGQGAANRISKQSTTASAGGSTAAGTASTPKTQQQQAAAAKNG
KSPSKTPGRRRKGRNKCRKRK*

GH01941.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:23:34
Subject Length Description Subject Range Query Range Score Percent Strand
calypso-PA 471 CG8445-PA 1..471 1..471 2429 100 Plus
calypso-PB 471 CG8445-PB 1..471 1..471 2429 100 Plus
Uch-L5-PB 324 CG3431-PB 1..300 39..393 444 31.9 Plus
Uch-L5-PA 324 CG3431-PA 1..300 39..393 444 31.9 Plus
Uch-L5R-PA 340 CG1950-PA 15..314 36..393 433 30.9 Plus