Clone GH02396 Report

Search the DGRC for GH02396

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:23
Well:96
Vector:pOT2
Associated Gene/TranscriptUch-RA
Protein status:GH02396.pep: gold
Preliminary Size:1022
Sequenced Size:1068

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4265 2000-02-14 Blastp of sequenced clone
CG4265 2001-01-01 Release 2 assignment
CG4265 2003-01-01 Sim4 clustering to Release 3
Uch 2008-04-29 Release 5.5 accounting
Uch 2008-08-15 Release 5.9 accounting
Uch 2008-12-18 5.12 accounting

Clone Sequence Records

GH02396.complete Sequence

1068 bp (1068 high quality bases) assembled on 2000-02-14

GenBank Submission: AF145600

> GH02396.complete
GGAAAAAAGTAAAGCTCGTCAAAAGTGCCGGTAATTGTGTGTAGAAATCC
TTCATTTTCCTGTGAATTTTCAATCAGATCACTGCTAAAGCCAAATTCAA
AAATATGTTAACCTGGACGCCACTTGAATCTAATCCCGAGGTTTTGACCA
AGTACATACATAAACTGGGCGTGTCGCCAGCCTGGTCGGTAACTGACGTC
ATTGGATTGGAAGATGACACCTTGGAATGGATTCCGCGTCCCGTAAAGGC
GTTCATTTTGCTCTTCCCGTGCAGCGAAACCTATGAGAAGCACCGCGCCG
AGGAGCACGATCGGATTAAGGAGGTGGAGGAGCAGCATCCCGAGGATCTC
TTCTACATGCGCCAGTTCACCCACAACGCCTGTGGAACCGTCGCCCTGAT
CCACAGCGTGGCCAACAACAAAGAAGTGGACATTGACCGCGGAGTACTGA
AGGACTTCCTGGAGAAGACAGCTTCCTTGTCCCCGGAGGAACGCGGACGG
GCCCTCGAAAAAGACGAGAAGTTCACCGCCGATCATGAGGCCTTGGCTCA
AGAGGGCCAGACGAATGCCGCCAATCATGAGAAGGTGATCCACCACTTCA
TCGCACTGGTGAACAAGGAGGGTACTCTGTACGAGCTGGATGGCCGCAAG
TCCTTCCCGATCAAGCACGGACCGACTTCGGAGGAGACTTTTGTGAAGGA
TGCGGCCAAGGTCTGCAAGGAGTTCATGGCTCGCGATCCCAACGAAGTGC
GCTTCACCGTTTTGGCCTTGACCGCGGCACAACAATAGGGTGGAACTAAT
CCCATAACTGAGAACCACCAAGATCCCGGATCTGCCAGACTATATATTTA
TATATCCAACATATTTTAAACCAGGCTGCAAAGGCGAACGAAGCCCCGCC
TTTCAGCCGGTCAATAGTTTACGCATATTTATTCCGCATTGAGCCAAAGC
CGCATATGTATTGGGAACACCATGATTGTTATTAAAGAGTGCACTCTAGC
TTGATGCTAAGCTTATTCTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA

GH02396.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-RA 1276 Uch-RA 146..1166 2..1022 5105 100 Plus
Uch.e 1188 Uch.e 307..1188 139..1020 4410 100 Plus
Uch.d 1155 Uch.d 426..1155 291..1020 3650 100 Plus
Uch.d 1155 Uch.d 146..425 2..281 1400 100 Plus
Uch.e 1188 Uch.e 146..284 2..140 695 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 18:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2212468..2213063 1020..425 2920 99.3 Minus
chr2L 23010047 chr2L 2213145..2213287 424..282 715 100 Minus
chr2L 23010047 chr2L 2213346..2213488 281..139 715 100 Minus
chr2L 23010047 chr2L 2213623..2213763 142..2 705 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 18:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-RB 684 CG4265-PB 1..684 105..788 3420 100 Plus
Uch-RA 684 CG4265-PA 1..684 105..788 3420 100 Plus
Uch-RC 675 CG4265-PC 1..675 105..788 3250 98.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:27:44 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 18:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-RB 1044 CG4265-RB 26..1044 2..1020 5095 100 Plus
Uch-RA 1196 CG4265-RA 178..1196 2..1020 5095 100 Plus
Uch-RC 1035 CG4265-RC 26..1035 2..1020 4925 99.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-PB 227 CG4265-PB 1..227 105..785 1194 100 Plus
Uch-PA 227 CG4265-PA 1..227 105..785 1194 100 Plus
Uch-PC 224 CG4265-PC 1..224 105..785 1163 98.7 Plus
Uch-L5-PB 324 CG3431-PB 8..227 114..785 182 26.4 Plus
Uch-L5-PA 324 CG3431-PA 8..227 114..785 182 26.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 18:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2212736..2213333 1022..425 2990 100 Minus
2L 23513712 2L 2213415..2213557 424..282 715 100 Minus
2L 23513712 2L 2213616..2213758 281..139 715 100 Minus
2L 23513712 2L 2213894..2214034 142..2 705 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2212736..2213333 1022..425 2990 100 Minus
2L 23513712 2L 2213415..2213557 424..282 715 100 Minus
2L 23513712 2L 2213616..2213758 281..139 715 100 Minus
2L 23513712 2L 2213894..2214034 142..2 705 100 Minus
Blast to na_te.dros performed on 2014-11-26 18:54:30 has no hits.

GH02396.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:12:16 Download gff for GH02396.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2213625..2213763 1..140 99   Minus
chr2L 2213346..2213486 141..281 100 <- Minus
chr2L 2213145..2213287 282..424 100 <- Minus
chr2L 2212468..2213063 425..1020 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:07:26 Download gff for GH02396.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-RA 1..684 105..788 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:33:41 Download gff for GH02396.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-RB 1..684 105..788 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:35:45 Download gff for GH02396.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-RA 1..684 105..788 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:08:12 Download gff for GH02396.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-RA 1..684 105..788 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:12:16 Download gff for GH02396.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-RA 1..684 105..788 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:35:55 Download gff for GH02396.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-RA 145..1164 1..1020 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:33:41 Download gff for GH02396.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-RA 145..1164 1..1020 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:35:45 Download gff for GH02396.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-RA 177..1196 1..1020 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:08:12 Download gff for GH02396.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-RA 145..1164 1..1020 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:12:16 Download gff for GH02396.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-RA 177..1196 1..1020 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:12:16 Download gff for GH02396.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2213896..2214034 1..140 99   Minus
2L 2213616..2213756 141..281 100 <- Minus
2L 2213415..2213557 282..424 100 <- Minus
2L 2212738..2213333 425..1020 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:35:45 Download gff for GH02396.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2213896..2214034 1..140 99   Minus
arm_2L 2213616..2213756 141..281 100 <- Minus
arm_2L 2213415..2213557 282..424 100 <- Minus
arm_2L 2212738..2213333 425..1020 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:45:46 Download gff for GH02396.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2213896..2214034 1..140 99   Minus
2L 2213616..2213756 141..281 100 <- Minus
2L 2213415..2213557 282..424 100 <- Minus
2L 2212738..2213333 425..1020 100 <- Minus

GH02396.pep Sequence

Translation from 104 to 787

> GH02396.pep
MLTWTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAF
ILLFPCSETYEKHRAEEHDRIKEVEEQHPEDLFYMRQFTHNACGTVALIH
SVANNKEVDIDRGVLKDFLEKTASLSPEERGRALEKDEKFTADHEALAQE
GQTNAANHEKVIHHFIALVNKEGTLYELDGRKSFPIKHGPTSEETFVKDA
AKVCKEFMARDPNEVRFTVLALTAAQQ*

GH02396.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 14:02:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15299-PA 227 GF15299-PA 1..226 1..226 1067 86.7 Plus
Dana\GF19511-PA 413 GF19511-PA 26..246 3..227 200 28 Plus
Dana\GF12763-PA 470 GF12763-PA 44..272 4..222 147 24.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 14:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24548-PA 227 GG24548-PA 1..227 1..227 1146 93 Plus
Dere\GG19562-PA 335 GG19562-PA 18..236 4..227 188 29 Plus
Dere\GG22294-PA 471 GG22294-PA 46..274 4..222 145 24.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 14:02:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11470-PA 229 GH11470-PA 1..228 1..226 890 73.7 Plus
Dgri\GH16209-PA 324 GH16209-PA 7..227 3..227 185 25.4 Plus
Dgri\GH22997-PA 462 GH22997-PA 30..258 4..222 148 26.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-PB 227 CG4265-PB 1..227 1..227 1194 100 Plus
Uch-PA 227 CG4265-PA 1..227 1..227 1194 100 Plus
Uch-PC 224 CG4265-PC 1..224 1..227 1163 98.7 Plus
Uch-L5-PB 324 CG3431-PB 8..227 4..227 182 26.4 Plus
Uch-L5-PA 324 CG3431-PA 8..227 4..227 182 26.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 14:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16929-PA 229 GI16929-PA 1..229 1..227 924 72.9 Plus
Dmoj\GI13355-PA 324 GI13355-PA 7..227 3..227 180 25 Plus
Dmoj\GI18963-PA 461 GI18963-PA 30..259 4..223 147 25.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 14:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19416-PA 227 GL19416-PA 1..226 1..226 1064 87.2 Plus
Dper\GL17965-PA 324 GL17965-PA 7..227 3..227 188 25.4 Plus
Dper\GL20225-PA 351 GL20225-PA 24..253 2..227 155 24.9 Plus
Dper\GL10684-PA 475 GL10684-PA 45..273 4..222 145 25.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 14:02:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18067-PA 227 GA18067-PA 1..226 1..226 1061 86.7 Plus
Dpse\GA17448-PA 324 GA17448-PA 7..227 3..227 188 25.4 Plus
Dpse\GA26899-PA 351 GA26899-PA 24..253 2..227 156 24.9 Plus
Dpse\GA21084-PA 475 GA21084-PA 45..273 4..222 145 25.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 14:02:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18256-PA 227 GM18256-PA 1..227 1..227 1154 93.8 Plus
Dsec\GM23432-PA 175 GM23432-PA 1..174 1..172 749 83.3 Plus
Dsec\GM13220-PA 340 GM13220-PA 24..243 3..227 226 30.6 Plus
Dsec\GM20083-PA 471 GM20083-PA 46..274 4..222 147 24.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 14:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22865-PA 227 GD22865-PA 1..227 1..227 1160 94.3 Plus
Dsim\GD15942-PA 426 GD15942-PA 110..329 3..227 201 28.9 Plus
Dsim\GD25561-PA 471 GD25561-PA 46..274 4..222 146 24.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 14:02:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17211-PA 229 GJ17211-PA 1..229 1..227 936 75.5 Plus
Dvir\GJ13185-PA 325 GJ13185-PA 7..227 3..227 182 25.4 Plus
Dvir\GJ20906-PA 462 GJ20906-PA 30..258 4..222 149 26.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 14:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15133-PA 227 GK15133-PA 1..226 1..226 1064 86.3 Plus
Dwil\GK20334-PA 324 GK20334-PA 7..227 3..227 174 25 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 14:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15202-PA 227 GE15202-PA 1..226 1..226 1143 93.4 Plus
Dyak\GE16722-PA 329 GE16722-PA 17..236 3..227 190 28.4 Plus
Dyak\GE14091-PA 471 GE14091-PA 46..274 4..222 147 24.8 Plus

GH02396.hyp Sequence

Translation from 104 to 787

> GH02396.hyp
MLTWTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAF
ILLFPCSETYEKHRAEEHDRIKEVEEQHPEDLFYMRQFTHNACGTVALIH
SVANNKEVDIDRGVLKDFLEKTASLSPEERGRALEKDEKFTADHEALAQE
GQTNAANHEKVIHHFIALVNKEGTLYELDGRKSFPIKHGPTSEETFVKDA
AKVCKEFMARDPNEVRFTVLALTAAQQ*

GH02396.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:26:08
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-PB 227 CG4265-PB 1..227 1..227 1194 100 Plus
Uch-PA 227 CG4265-PA 1..227 1..227 1194 100 Plus
Uch-PC 224 CG4265-PC 1..224 1..227 1163 98.7 Plus
Uch-L5-PB 324 CG3431-PB 8..227 4..227 182 26.4 Plus
Uch-L5-PA 324 CG3431-PA 8..227 4..227 182 26.4 Plus