Clone GH02435 Report

Search the DGRC for GH02435

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:24
Well:35
Vector:pOT2
Associated Gene/Transcriptmorgue-RA
Protein status:GH02435.pep: gold
Preliminary Size:1676
Sequenced Size:1698

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15437 2000-02-14 Blastp of sequenced clone
CG15437 2001-01-01 Release 2 assignment
CG15437 2003-01-01 Sim4 clustering to Release 3
morgue 2008-04-29 Release 5.5 accounting
morgue 2008-08-15 Release 5.9 accounting
morgue 2008-12-18 5.12 accounting

Clone Sequence Records

GH02435.complete Sequence

1698 bp (1698 high quality bases) assembled on 2000-02-14

GenBank Submission: AF145603

> GH02435.complete
ATGACTAGCTGCGTGCCAGCGCATCAGCAAAAGGACCAGGAGCAGTTGCT
AAAGGAACTGGCCAGCAGTGGCGACGAGATGGACGACCCGGACGATCCGG
ACCAGGAACACCACCAGCTGGTAGAGCCGACCTTCTCTTTTTCGAATAGT
AACACCTGCTGGGTGTGCAACGGCTACTATGGGCCCAACTTCGGGGAGCC
GTTGTGCGGCGCCTGCCACGCCTTCCTGTACAACGCACAGCGGGCGGAGG
AGCTGCTCACGGAGCTTTCCGATGACGAGGATTCTGGGAACGACGAGCCG
CCGTTCAAGGACAAGCAGGAAGACGAGGAGACCGAAAACGACGTAGACAT
CATGGGCTTTGAGGATCTGGAGGACCCCCAACCGGCAGCCGTGCCACAAC
ATCCAAATCCGCAGCCACCAATGGAGCCACAGGATCAACAGCCAGCCCAA
CCAGTTATAGATCTGCCACAGCCGGTGCCGGAGGCTGCGGCACCACGACG
CGAGTCTCCGGAGCGCGACTTTGAGCACGAGAGAGCCATTAATCCCTTCC
TGCTGCCCATTAAGCGTCCGCGGGCCACGGCTCCCTTGGCTCTGCCCCAT
TACATGCATGAGCTGGCCGATGGAAGGGCGCGAGTGCATGAATACAACGC
CGCCAGCGGAAGCGGAGCAAGTGGCAGCAGCAGAAACATTGTCAACATAA
TACCCGTCGAGGTGATGCTGAAAATATTTGCCTATTTGGACGACATGTCG
CTGTGGATGGCTAGTGAAGTTTGCAAGCAATGGCACGACATTGTCGGGAA
AAACACGGCCCAGAGCATGTGGAAGGCGTATATCAAGCAGCGCTGGCCGC
TGTTCGACAGTTTGGCAGACAATCCAAACTGGTATCGGCTGTACGGGGCA
CTGATGTCTTCCTGCTTCTGTCGCACTTGCCTGATTGAGATGGGCGGTCG
GGGTCAGGATGCACAGGAGGCAGATCCACAGCTGGGCGATCGGGAGCCGG
GCAATGTAATGCGCAACAACTTTCTGCGCGGTGAAGCCAATCTGCTGAAC
AGCTACGAATCTGAGGGCATATCGGCCATACCGTTGGATCGGCAAAACAA
CTACTGGCAGGCGACAATTCTGGGGCCACCGGGCAGTCCCTACGAAGGCG
GCAAGTTCTTCCTGTTCATATACTTCCCGGAGCGATATCCGATGACGCCG
CCCACAGTACGTTTCCTCACCAAAATCCTGCATCCGAATGTTTCGCGGCA
TGGGGACGTGGGCATCGACATCTTCCAGCAGCACAACTGGTCTCTGGCGC
TGAACGTGGCCAAGGTGCTGCTTTCTGTGCAGAGCCTGCTGACCGATCCG
TATACCGAAGTCTGCATGGAGCCTGAACTTGGATACATCTATGAGCACGA
GCGCGAAAGGTTCGAGCAACTGGTGCGCGCGTGGACATGGAAGTACGCCA
TGTACGAGCTAATTGCACCGCGCTAGAAGATCAAAAGCCCTCCAAGGACA
ATGGACTGAAAGTTGGAAACTACCCCTCTTTACGTTGTAACTACATATGC
CTGTGTATTTAGCTTAGTTGTGCCATCTGGATTGTTTATTTTGGCCTCCC
CTCTCACTTTTCCTGCGCTCCAGGTTGAAACGTAGTCGAAATTACTTAAC
CTTATAATAAATGTATGCTTTAAGTTAAAAAAAAAAAAAAAAAAAAAA

GH02435.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
morgue-RA 1844 morgue-RA 108..1784 1..1677 8385 100 Plus
CG15432.a 617 CG15432.a 461..617 1677..1521 785 100 Minus
CG15432-RA 557 CG15432-RA 441..557 1677..1561 585 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:44:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4442007..4443539 1676..144 7665 100 Minus
chr2L 23010047 chr2L 4443601..4443744 144..1 705 99.3 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:44:31
Subject Length Description Subject Range Query Range Score Percent Strand
morgue-RA 1476 CG15437-PA 1..1476 1..1476 7380 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:27:50 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:44:29
Subject Length Description Subject Range Query Range Score Percent Strand
morgue-RA 1749 CG15437-RA 74..1749 1..1676 8380 100 Plus
CG15432-RC 557 CG15432-RC 442..557 1676..1561 580 100 Minus
CG15432-RB 536 CG15432-RB 421..536 1676..1561 580 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:44:33
Subject Length Description Subject Range Query Range Score Percent Strand
morgue-PA 491 CG15437-PA 1..491 1..1473 2190 100 Plus
eff-PC 147 CG7425-PC 22..147 1072..1452 336 50.4 Plus
eff-PB 147 CG7425-PB 22..147 1072..1452 336 50.4 Plus
eff-PA 147 CG7425-PA 22..147 1072..1452 336 50.4 Plus
CG3473-PB 151 CG3473-PB 22..149 1066..1452 259 42.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4442869..4444402 1677..144 7670 100 Minus
2L 23513712 2L 4444464..4444607 144..1 720 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:01:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4442869..4444402 1677..144 7670 100 Minus
2L 23513712 2L 4444464..4444607 144..1 720 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:44:28 has no hits.

GH02435.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 09:56:14 Download gff for GH02435.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4443601..4443744 1..144 99   Minus
chr2L 4442007..4443538 145..1676 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:07:40 Download gff for GH02435.complete
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 1..1476 1..1476 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:32:44 Download gff for GH02435.complete
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 1..1476 1..1476 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:56:15 Download gff for GH02435.complete
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 1..1476 1..1476 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:07:09 Download gff for GH02435.complete
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 1..1476 1..1476 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:56:14 Download gff for GH02435.complete
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 1..1476 1..1476 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:34:39 Download gff for GH02435.complete
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 71..1746 1..1676 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:32:44 Download gff for GH02435.complete
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 71..1746 1..1676 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:56:15 Download gff for GH02435.complete
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 74..1749 1..1676 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:07:09 Download gff for GH02435.complete
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 71..1746 1..1676 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:56:14 Download gff for GH02435.complete
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 74..1749 1..1676 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:56:14 Download gff for GH02435.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4444464..4444607 1..144 100   Minus
2L 4442870..4444401 145..1676 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:56:15 Download gff for GH02435.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4444464..4444607 1..144 100   Minus
arm_2L 4442870..4444401 145..1676 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:44:44 Download gff for GH02435.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4444464..4444607 1..144 100   Minus
2L 4442870..4444401 145..1676 100 <- Minus

GH02435.pep Sequence

Translation from 0 to 1475

> GH02435.pep
MTSCVPAHQQKDQEQLLKELASSGDEMDDPDDPDQEHHQLVEPTFSFSNS
NTCWVCNGYYGPNFGEPLCGACHAFLYNAQRAEELLTELSDDEDSGNDEP
PFKDKQEDEETENDVDIMGFEDLEDPQPAAVPQHPNPQPPMEPQDQQPAQ
PVIDLPQPVPEAAAPRRESPERDFEHERAINPFLLPIKRPRATAPLALPH
YMHELADGRARVHEYNAASGSGASGSSRNIVNIIPVEVMLKIFAYLDDMS
LWMASEVCKQWHDIVGKNTAQSMWKAYIKQRWPLFDSLADNPNWYRLYGA
LMSSCFCRTCLIEMGGRGQDAQEADPQLGDREPGNVMRNNFLRGEANLLN
SYESEGISAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPERYPMTP
PTVRFLTKILHPNVSRHGDVGIDIFQQHNWSLALNVAKVLLSVQSLLTDP
YTEVCMEPELGYIYEHERERFEQLVRAWTWKYAMYELIAPR*

GH02435.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24066-PA 478 GF24066-PA 1..477 1..490 2155 85.5 Plus
Dana\GF18131-PA 147 GF18131-PA 22..147 358..484 335 50.4 Plus
Dana\GF10262-PA 350 GF10262-PA 210..324 368..483 274 45.7 Plus
Dana\GF14068-PA 224 GF14068-PA 113..222 369..479 258 48.3 Plus
Dana\GF19231-PA 151 GF19231-PA 22..149 356..484 253 38 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24379-PA 491 GG24379-PA 1..491 1..491 2376 97.4 Plus
Dere\GG21088-PA 147 GG21088-PA 22..147 358..484 335 50.4 Plus
Dere\GG24249-PA 151 GG24249-PA 22..149 356..484 274 42.6 Plus
Dere\GG10359-PA 232 GG10359-PA 118..232 369..484 270 47.9 Plus
Dere\GG17819-PA 151 GG17819-PA 22..149 356..484 256 38.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11661-PA 497 GH11661-PA 1..494 1..490 1828 71.4 Plus
Dgri\GH14086-PA 147 GH14086-PA 22..147 358..484 335 50.4 Plus
Dgri\GH13340-PA 240 GH13340-PA 126..240 369..484 270 47.9 Plus
Dgri\GH22592-PA 151 GH22592-PA 22..149 356..484 256 38.8 Plus
Dgri\GH17677-PA 151 GH17677-PA 22..149 356..484 256 38.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
morgue-PA 491 CG15437-PA 1..491 1..491 2680 100 Plus
eff-PC 147 CG7425-PC 22..147 358..484 336 50.4 Plus
eff-PB 147 CG7425-PB 22..147 358..484 336 50.4 Plus
eff-PA 147 CG7425-PA 22..147 358..484 336 50.4 Plus
CG3473-PB 151 CG3473-PB 22..149 356..484 259 42.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17963-PA 501 GI17963-PA 1..500 1..490 1893 74.4 Plus
Dmoj\GI10619-PA 147 GI10619-PA 22..147 358..484 335 50.4 Plus
Dmoj\GI17815-PA 240 GI17815-PA 126..240 369..484 270 47.9 Plus
Dmoj\GI22711-PA 151 GI22711-PA 22..149 356..484 256 38.8 Plus
Dmoj\GI21493-PA 151 GI21493-PA 22..149 356..484 255 38.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15422-PA 488 GL15422-PA 1..488 1..491 1997 78.6 Plus
Dper\GL23670-PA 147 GL23670-PA 22..147 358..484 335 50.4 Plus
Dper\GL22516-PA 220 GL22516-PA 68..207 342..483 303 42.3 Plus
Dper\GL22792-PA 285 GL22792-PA 121..277 329..483 267 37.7 Plus
Dper\GL26387-PA 228 GL26387-PA 114..227 369..483 265 48.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13727-PA 488 GA13727-PA 1..488 1..491 1997 78.6 Plus
Dpse\GA26693-PA 147 GA26693-PA 22..147 358..484 335 50.4 Plus
Dpse\GA24534-PA 212 GA24534-PA 28..196 317..483 309 39.2 Plus
Dpse\GA23199-PA 187 GA23199-PA 42..154 369..483 274 46.1 Plus
Dpse\GA23419-PA 176 GA23419-PA 7..168 315..483 271 36.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:55:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18094-PA 491 GM18094-PA 1..491 1..491 2625 99 Plus
Dsec\GM25828-PA 147 GM25828-PA 22..147 358..484 335 50.4 Plus
Dsec\GM16552-PA 151 GM16552-PA 22..149 356..484 272 43.4 Plus
Dsec\GM14762-PA 151 GM14762-PA 22..149 356..484 272 43.4 Plus
Dsec\GM11457-PA 232 GM11457-PA 118..232 369..484 269 47.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22710-PA 491 GD22710-PA 1..491 1..491 2626 99.2 Plus
Dsim\GD20402-PA 147 GD20402-PA 22..147 358..484 335 50.4 Plus
Dsim\GD21999-PA 151 GD21999-PA 22..149 356..484 272 43.4 Plus
Dsim\GD22227-PA 232 GD22227-PA 118..232 369..484 267 47.9 Plus
Dsim\GD17149-PA 151 GD17149-PA 22..149 356..484 256 38.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17736-PA 506 GJ17736-PA 44..506 40..491 1838 75.6 Plus
Dvir\GJ22971-PA 147 GJ22971-PA 22..147 358..484 335 50.4 Plus
Dvir\GJ17643-PA 240 GJ17643-PA 126..240 369..484 267 47.9 Plus
Dvir\GJ23435-PA 151 GJ23435-PA 22..149 356..484 256 38.8 Plus
Dvir\GJ19035-PA 151 GJ19035-PA 22..149 356..484 254 38.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24680-PA 492 GK24680-PA 1..492 1..491 1753 71.1 Plus
Dwil\GK11688-PA 147 GK11688-PA 22..147 358..484 335 50.4 Plus
Dwil\GK21643-PA 151 GK21643-PA 22..151 356..486 275 40.5 Plus
Dwil\GK23983-PA 235 GK23983-PA 121..235 369..484 267 47.9 Plus
Dwil\GK25846-PA 151 GK25846-PA 22..149 356..484 256 38.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\morgue-PA 491 GE14733-PA 1..491 1..491 2454 97.4 Plus
Dyak\eff-PA 147 GE26430-PA 22..147 358..484 335 50.4 Plus
Dyak\GE24917-PA 151 GE24917-PA 22..149 356..484 277 43.4 Plus
Dyak\GE13339-PA 232 GE13339-PA 118..232 369..484 270 47.9 Plus
Dyak\GE17114-PA 151 GE17114-PA 22..149 356..484 256 38.8 Plus

GH02435.hyp Sequence

Translation from 1 to 1475

> GH02435.hyp
MTSCVPAHQQKDQEQLLKELASSGDEMDDPDDPDQEHHQLVEPTFSFSNS
NTCWVCNGYYGPNFGEPLCGACHAFLYNAQRAEELLTELSDDEDSGNDEP
PFKDKQEDEETENDVDIMGFEDLEDPQPAAVPQHPNPQPPMEPQDQQPAQ
PVIDLPQPVPEAAAPRRESPERDFEHERAINPFLLPIKRPRATAPLALPH
YMHELADGRARVHEYNAASGSGASGSSRNIVNIIPVEVMLKIFAYLDDMS
LWMASEVCKQWHDIVGKNTAQSMWKAYIKQRWPLFDSLADNPNWYRLYGA
LMSSCFCRTCLIEMGGRGQDAQEADPQLGDREPGNVMRNNFLRGEANLLN
SYESEGISAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPERYPMTP
PTVRFLTKILHPNVSRHGDVGIDIFQQHNWSLALNVAKVLLSVQSLLTDP
YTEVCMEPELGYIYEHERERFEQLVRAWTWKYAMYELIAPR*

GH02435.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
morgue-PA 491 CG15437-PA 1..491 1..491 2680 100 Plus
eff-PC 147 CG7425-PC 22..147 358..484 336 50.4 Plus
eff-PB 147 CG7425-PB 22..147 358..484 336 50.4 Plus
eff-PA 147 CG7425-PA 22..147 358..484 336 50.4 Plus
CG3473-PB 151 CG3473-PB 22..149 356..484 259 42.6 Plus