Clone GH02610 Report

Search the DGRC for GH02610

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:26
Well:10
Vector:pOT2
Associated Gene/TranscriptLin29-RA
Protein status:GH02610.pep: gold
Preliminary Size:3905
Sequenced Size:3935

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2052 2007-09-25 DGC5 pick
CG2052 2008-04-29 Picked prior to 5.5

Clone Sequence Records

GH02610.complete Sequence

3935 bp assembled on 2009-05-14

GenBank Submission: BT083451.1

> GH02610.complete
GCCGCCAGGTTATCTGTAGTTGTTTGCTGGGAGCGACTTCCAAGTCTCAG
CCGTAATCGTAACCGTAATCGAGGCCGTGCATATAGACAGTCACTGTATT
CTTCCAACAAAAAAAACCTCGTAAAGAGGCAATAAAATGATATGAAATTA
CGATGCTTTAACCAGGCCCAAACTTCGCACAGTTGGCACCCCAGATCCGT
GTTCAGGGTCGTAAGCAGTTGTCCTCCCGATCGAAAAAAACGGCCAAGCC
CAGCGAGCTGGCAAATCTGTATTGGCCATCTCCTAACAAATTATCTTGGA
ATGTTTAAAATGGACTCCGCAGACTTCTGGCAGCAAGCGCGTGCTCCGTT
TGGTCTGCAAACTGCGCTTCACCAATACTCTTCCCCCCCGAATCAACAGC
CAATATCCCACCACGCCCTGCACCACTCCGTTCCGCAGGAGAACGAGCAG
TTGGCCGGAGTTCAACCAGAAGGTCCAGCAGCAGGATCAGGCGTAGTGGG
CAACAACAGTTCCATGGCAATTTCCGGCACCAATTCAACTGTGGGCAGCA
AGGCGGAGTCCAGTCACATTCCGCAGCAGCACTCAGAGCAGCAGTCATAT
GGAAGCGACTCCTTCCGAGGAACGCAGTCGCCCCAGCTGAGTAGCCACCA
CCTGTTGTTTAACGCCGCTGCAGCCGCTGCTGCGGCGGTCCACCTCAAGT
CCACGGCGATGCAGAATAACCTCTCGCCAATAGGCGATCAGGTGCAAAAT
AACCTTCGCAACTACGGACAAGGATCCTTAAACGCCTTATGTGGGATCAA
GCCCAAGCAGGAGATGGATGCGAAGACGCCCCTACAGCCGTTGGACGAGT
GTCCCCACCCTCTAGTTCAGGCGCAGGCCCAGTCCCAGTACGGCGGAGAC
TACTACGACGTGGCCGACCCACAGGCTAGAGAAATCTCGGAAGGTCGAGC
ACTGATAATCGGACTCGGAGCACCCAGTACGGTGTCCACCGACGATGCAC
AGTCCAGTGCGCCGTCTCATCAGCTGGCAGGGACTGGCCGAGCATTGCAG
ACTCATCAGTGCAAGCCAATGTCCCCTGGAACAGTTGGTAGCTCGAATTT
GGGCGCAGGACGAAGATCCGCACCCACAACAATAAGCAAGACCTTTTCGC
AGGGTCAGCAGTCCCCTCAGCACTCTACAACGCCATCCGGAGGCAGCACG
ACGCCCGACATCAAATACAATAACGACAAAATGGCCAATGAAATTCAGCT
TCAGCTATCCCGTTCGAGCAGCGCAGCGGCGATCAGTGAACGCACCCTCG
AAGAATGTTGGTCAACCCTACAACGACTATTTATGCACAAAAGCGCGATG
CAGCAAATACAGCAGCAGATTCCTCGCGTTGGCCTGGGCACCCACGGCGT
GACCGGCTCGGCCAACTTAGGTGGCAGTATTACGCCTAGCTCGGATACCA
AGCCGCACCAGTGCCAGCAATGTATGAAGAGCTTTTCCAGTAACCACCAG
CTCGTGCAACACATCAGGGTACACACTGGAGAGAAGCCATACAAGTGTTC
CTACTGTGATCGTAGATTTAAGCAGTTGTCGCACGTCCAGCAGCACACGC
GCCTGCACACAGGAGAACGACCCTATAAATGCCATCTGCCAGACTGCGGT
CGAGCCTTTATACAGCTTTCAAATCTACAACAGCATCTACGAAACCATGA
CGCTCAGGTGGAGCGTGCCAAAAATCGTCCTTTTCACTGCAACATATGTG
GAAAGGGTTTCGCCACTGAATCTAGCCTGCGTACACATACATCGAAGGAG
CTACAGCTGCATCTTGGTGTCTTGCAGCAGCATGCCGCACTAATAGGTGG
TCCAAACGCTACGTCCTGTCCGGTGTGCCATAAACTTTTCCTTGGCACTG
AAGCCCTTGTGGACCACATGAAACATGTTCATAAGGAAAAGAGCCCCCCA
CCTGGTGGCTCAGCCTCATCCCAGTTTAGCGAGCTCAATCAGATAGTTAC
GGGCAATGGAAACGGAACTGGATCTAGCAATGAACAAATTGCTACCCAAT
GCACAACTGAATCGAACTCGCATCAGGCCACTGTTGGCTCTAGCTTAATC
GACAGCTTTTTGGGCAAGCGAAGAACTGCCAACCATCCTTGCCCAGTTTG
CGGTAAACATTATGTCAACGAGGGTTCCCTAAGGAAACATCTGGCTTGCC
ACGCTGAGAACTCCCAACTTACAAACAGCCTGCGAATGTGGCCATGTAGC
GTTTGCCAGGCCGTCTTCACTCATGAAAACGGCCTTCTTACCCATATGGA
GTCAATGCGCATGGATCCGAAACATCAGTTCGCGGCTCAATACGTACTAT
CCCGGGCAGCTGCAGAGCAGCGAGAACGAGAATCTCTTCTAGCGGTTACC
TTAGCCGCCAGCAGTGGCGCTAGTACAAGAATCGGAATTGCGGATGCCGG
AAACGTTTTGCCTACGGGAGCTCACAACTCGGACGGATCCAACTCGAAAT
GCCCTTCCCCTTCGGCTAACTCGGAATGCTCTTCAAACGGACGCCTCTCG
TCATCGACAACATCAGATCAAGACCAAGACATCGACCATGGTTTAAGTGA
AAATGAGAACAGCAACCAGAACAACATAGGCAGTTCCACGAATAACAACA
ATAATTGCACGAGTAACAACAACGCTAGCTCTCATAAAATGGCTGAGCTT
CGACTTCCGGGAACCGGCCAATATACCATGGACGCGGAACTGCATGTCGC
CAACCGGATGTCACTAATGGCCGCTGCTGCTGCAGCAGTTGCTGCGTCAC
GACCACAAGACGGAGTGGACACTTCAGCAGTCCCGAGCGCGGCGGTTCAG
GCCGCTGTGGTTAATCTGGCAGCTGCAATGCGAATGAACAATTCCAGCAA
CGGTGCTACCCCCTACCAACAACATCACGCCGATCACACACAGGCACACC
AGACACATATCCTTCAACATGCACACCCACATCACCACCAACAGCAGCAG
GCTCCGCAGCACCAACAGCAACAGTTGTCCCATTTGCTAGTCCATACTCA
CCCCAGCAACAGCAACTCCCGTTCTCAAAGTTCACCAAACATAAATGTGC
CAAGTTTACAGAACGAATCTACTGCCGCCTCGATCGCTATGAACATGAAC
GTACATATGATGCGCGGTTCCCTCGACCCGGACCCGAGTTTAGGAGGAAT
GCATGGAATAGAAGTTCTCCACCAACACCAGCAGCAGCACCACCACCATC
ATCACCACCACACGTCAAACTATCCGCAGCACGCCGTAACTCCTACCAAC
CAACATACTCACCCACACCCCCAGACACACCAAACCGCCCATCACCATAC
GAGTCCTGAAACGGCGCTCCGAATGCACCAGGCTGAAGCGATCTTACGCT
CGCATACCGAAGCAGCATTCCGACTGGCAACTGGATCTGGTCCTGACACC
GGAGTAAAATGCGAGGCTGATCAAAACCAGCTGAATAGTAACAATGCTGG
CAATGCTGGTGGCAATAGTGGAGGCAATAGCCAACAACATCGATTCCATG
CGAGTTCGAATCACCAAGAGAATCAACGACCATCGGACTCATGAAGTTCG
GCGATTCATTCCTCTAGGGATGACTGAGGACTGAGGATTGATACAGATAC
AGAATCAAGTACAACGATCTTTCTATTATGTCGATAGGATTCAATGCATG
TGAATGAGTAAAGCTTCATATATTAATACATTCATGGTAATTTATGAAAA
TGAGATTATGTATGTAAGTTTAAATAGGCAGTCATGCCCTAAGTTAGAAA
ACGAACCCATTTATTGTGCAATATCATCTACCGTCAATTTCGGCAGAAAA
ATAAATGTAAAAACTTTCGTGTTATGTTTACGTTTATAATAAGTTTAGAG
ATAAATGCTCGAAAATTAAAAAAAAAAAAAAAAAA

GH02610.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG2052.a 4187 CG2052.a 2..3919 1..3918 19590 100 Plus
CG2052-RA 4049 CG2052-RA 74..3991 1..3918 19590 100 Plus
CG2052-RB 3966 CG2052-RB 1869..3961 1826..3918 10465 100 Plus
CG2052-RB 3966 CG2052-RB 74..1874 1..1801 8990 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:59:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr4 1351717 chr4 410978..412099 1248..127 5610 100 Minus
chr4 1351717 chr4 396214..397205 3917..2926 4960 100 Minus
chr4 1351717 chr4 397668..398243 2925..2350 2880 100 Minus
chr4 1351717 chr4 398458..398782 2282..1958 1625 100 Minus
chr4 1351717 chr4 402696..402982 1613..1327 1435 100 Minus
chr4 1351717 chr4 399289..399476 1798..1611 940 100 Minus
chr4 1351717 chr4 398970..399137 1963..1796 840 100 Minus
chr4 1351717 chr4 413815..413943 129..1 645 100 Minus
chr4 1351717 chr4 407459..407541 1326..1244 415 100 Minus
chr4 1351717 chr4 398332..398400 2349..2281 345 100 Minus
chr4 1351717 chr4 397385..397438 2913..2860 240 96.3 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:59:30
Subject Length Description Subject Range Query Range Score Percent Strand
Lin29-RA 3453 CG2052-PA 1..3453 142..3594 17265 100 Plus
Lin29-RC 3453 CG2052-PC 1..3453 142..3594 17265 100 Plus
Lin29-RD 2376 CG2052-PD 31..2376 1249..3594 11730 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:28:12 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
Lin29-RA 3937 CG2052-RA 21..3937 1..3917 19585 100 Plus
Lin29-RC 5533 CG2052-RC 1743..5533 127..3917 18955 100 Plus
Lin29-RD 3163 CG2052-RD 495..3163 1249..3917 13345 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
Lin29-PA 1150 CG2052-PA 1..1147 142..3582 4743 100 Plus
Lin29-PC 1150 CG2052-PC 1..1147 142..3582 4743 100 Plus
Lin29-PB 1140 CG2052-PB 1..1137 142..3582 4673 99.1 Plus
Lin29-PD 791 CG2052-PD 8..788 1240..3582 2906 99.7 Plus
rn-PC 692 CG42277-PC 259..419 1444..1968 357 41.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 390425..391546 1248..127 5610 100 Minus
4 1348131 4 375639..376631 3918..2926 4965 100 Minus
4 1348131 4 377094..377669 2925..2350 2880 100 Minus
4 1348131 4 377884..378208 2282..1958 1625 100 Minus
4 1348131 4 382122..382408 1613..1327 1435 100 Minus
4 1348131 4 378715..378902 1798..1611 940 100 Minus
4 1348131 4 378396..378563 1963..1796 840 100 Minus
4 1348131 4 393262..393390 129..1 645 100 Minus
4 1348131 4 386907..386989 1326..1244 415 100 Minus
4 1348131 4 377758..377826 2349..2281 345 100 Minus
4 1348131 4 376811..376864 2913..2860 240 96.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:21:12
Subject Length Description Subject Range Query Range Score Percent Strand
4 1331231 4 390425..391546 1248..127 5610 100 Minus
4 1331231 4 375639..376631 3918..2926 4965 100 Minus
4 1331231 4 377094..377669 2925..2350 2880 100 Minus
4 1331231 4 377884..378208 2282..1958 1625 100 Minus
4 1331231 4 382122..382408 1613..1327 1435 100 Minus
4 1331231 4 378715..378902 1798..1611 940 100 Minus
4 1331231 4 378396..378563 1963..1796 840 100 Minus
4 1331231 4 393262..393390 129..1 645 100 Minus
4 1331231 4 386907..386989 1326..1244 415 100 Minus
4 1331231 4 377758..377826 2349..2281 345 100 Minus
4 1331231 4 376811..376864 2913..2860 240 96.2 Minus
Blast to na_te.dros performed 2014-11-27 14:59:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6719..6828 2914..3023 199 64.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2603..3008 3205..3591 165 55 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6757..6901 2869..3021 161 59.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2309..2390 2940..3024 157 67.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1503..1580 2947..3024 147 65.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6718..6795 2946..3023 147 65.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6722..6809 2980..3066 131 62.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6794 2990..3066 119 65.4 Plus

GH02610.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:21:11 Download gff for GH02610.complete
Subject Subject Range Query Range Percent Splice Strand
chr4 413816..413943 1..128 100   Minus
chr4 410978..412097 129..1248 100 <- Minus
chr4 407459..407536 1249..1326 100 <- Minus
chr4 402697..402982 1327..1612 100 <- Minus
chr4 399290..399474 1613..1797 100 <- Minus
chr4 398970..399135 1798..1963 100 <- Minus
chr4 398459..398776 1964..2281 100 <- Minus
chr4 398332..398399 2282..2349 100 <- Minus
chr4 397668..398243 2350..2925 100 <- Minus
chr4 396214..397205 2926..3917 95 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:59:06 Download gff for GH02610.complete
Subject Subject Range Query Range Percent Splice Strand
CG2052-RA 1..3453 142..3594 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:52:38 Download gff for GH02610.complete
Subject Subject Range Query Range Percent Splice Strand
Lin29-RA 1..3453 142..3594 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:56:20 Download gff for GH02610.complete
Subject Subject Range Query Range Percent Splice Strand
Lin29-RC 1..3453 142..3594 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:21:11 Download gff for GH02610.complete
Subject Subject Range Query Range Percent Splice Strand
Lin29-RC 1..3453 142..3594 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:58:55 Download gff for GH02610.complete
Subject Subject Range Query Range Percent Splice Strand
CG2052-RA 1..3917 1..3917 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:52:38 Download gff for GH02610.complete
Subject Subject Range Query Range Percent Splice Strand
Lin29-RA 1..3917 1..3917 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:56:20 Download gff for GH02610.complete
Subject Subject Range Query Range Percent Splice Strand
Lin29-RA 21..3937 1..3917 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:21:11 Download gff for GH02610.complete
Subject Subject Range Query Range Percent Splice Strand
Lin29-RA 21..3937 1..3917 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:21:11 Download gff for GH02610.complete
Subject Subject Range Query Range Percent Splice Strand
4 393263..393390 1..128 100   Minus
4 390425..391544 129..1248 100 <- Minus
4 386907..386984 1249..1326 100 <- Minus
4 382123..382408 1327..1612 100 <- Minus
4 378716..378900 1613..1797 100 <- Minus
4 378396..378561 1798..1963 100 <- Minus
4 377885..378202 1964..2281 100 <- Minus
4 377758..377825 2282..2349 100 <- Minus
4 377094..377669 2350..2925 100 <- Minus
4 375640..376631 2926..3917 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:56:20 Download gff for GH02610.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 413889..414016 1..128 100   Minus
arm_4 411051..412170 129..1248 100 <- Minus
arm_4 407533..407610 1249..1326 100 <- Minus
arm_4 402749..403034 1327..1612 100 <- Minus
arm_4 399342..399526 1613..1797 100 <- Minus
arm_4 399022..399187 1798..1963 100 <- Minus
arm_4 398511..398828 1964..2281 100 <- Minus
arm_4 398384..398451 2282..2349 100 <- Minus
arm_4 397720..398295 2350..2925 100 <- Minus
arm_4 396266..397257 2926..3917 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:43:27 Download gff for GH02610.complete
Subject Subject Range Query Range Percent Splice Strand
4 393263..393390 1..128 100   Minus
4 390425..391544 129..1248 100 <- Minus
4 386907..386984 1249..1326 100 <- Minus
4 382123..382408 1327..1612 100 <- Minus
4 378716..378900 1613..1797 100 <- Minus
4 378396..378561 1798..1963 100 <- Minus
4 377885..378202 1964..2281 100 <- Minus
4 377758..377825 2282..2349 100 <- Minus
4 377094..377669 2350..2925 100 <- Minus
4 375640..376631 2926..3917 100 <- Minus

GH02610.pep Sequence

Translation from 141 to 3593

> GH02610.pep
MKLRCFNQAQTSHSWHPRSVFRVVSSCPPDRKKRPSPASWQICIGHLLTN
YLGMFKMDSADFWQQARAPFGLQTALHQYSSPPNQQPISHHALHHSVPQE
NEQLAGVQPEGPAAGSGVVGNNSSMAISGTNSTVGSKAESSHIPQQHSEQ
QSYGSDSFRGTQSPQLSSHHLLFNAAAAAAAAVHLKSTAMQNNLSPIGDQ
VQNNLRNYGQGSLNALCGIKPKQEMDAKTPLQPLDECPHPLVQAQAQSQY
GGDYYDVADPQAREISEGRALIIGLGAPSTVSTDDAQSSAPSHQLAGTGR
ALQTHQCKPMSPGTVGSSNLGAGRRSAPTTISKTFSQGQQSPQHSTTPSG
GSTTPDIKYNNDKMANEIQLQLSRSSSAAAISERTLEECWSTLQRLFMHK
SAMQQIQQQIPRVGLGTHGVTGSANLGGSITPSSDTKPHQCQQCMKSFSS
NHQLVQHIRVHTGEKPYKCSYCDRRFKQLSHVQQHTRLHTGERPYKCHLP
DCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKGFATESSLRTHT
SKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKEK
SPPPGGSASSQFSELNQIVTGNGNGTGSSNEQIATQCTTESNSHQATVGS
SLIDSFLGKRRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMW
PCSVCQAVFTHENGLLTHMESMRMDPKHQFAAQYVLSRAAAEQRERESLL
AVTLAASSGASTRIGIADAGNVLPTGAHNSDGSNSKCPSPSANSECSSNG
RLSSSTTSDQDQDIDHGLSENENSNQNNIGSSTNNNNNCTSNNNASSHKM
AELRLPGTGQYTMDAELHVANRMSLMAAAAAAVAASRPQDGVDTSAVPSA
AVQAAVVNLAAAMRMNNSSNGATPYQQHHADHTQAHQTHILQHAHPHHHQ
QQQAPQHQQQQLSHLLVHTHPSNSNSRSQSSPNINVPSLQNESTAASIAM
NMNVHMMRGSLDPDPSLGGMHGIEVLHQHQQQHHHHHHHHTSNYPQHAVT
PTNQHTHPHPQTHQTAHHHTSPETALRMHQAEAILRSHTEAAFRLATGSG
PDTGVKCEADQNQLNSNNAGNAGGNSGGNSQQHRFHASSNHQENQRPSDS
*

GH02610.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23422-PA 540 GF23422-PA 1..538 57..608 1570 63.4 Plus
Dana\GF19327-PA 433 GF19327-PA 1..433 699..1150 1190 66.6 Plus
Dana\GF17309-PA 808 GF17309-PA 379..531 435..604 345 41.5 Plus
Dana\GF16538-PA 601 GF16538-PA 231..340 437..552 312 50 Plus
Dana\GF15824-PA 738 GF15824-PA 281..541 426..687 286 29.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16450-PA 1094 GG16450-PA 1..1094 57..1150 4539 90.9 Plus
Dere\GG25249-PA 941 GG25249-PA 514..666 435..604 343 41.5 Plus
Dere\GG23160-PA 539 GG23160-PA 159..328 437..625 314 38.1 Plus
Dere\GG13168-PA 926 GG13168-PA 294..570 413..720 287 27.5 Plus
Dere\GG23037-PA 502 GG23037-PA 199..412 417..642 277 32.6 Plus
Dere\GG13168-PA 926 GG13168-PA 546..659 435..554 266 41 Plus
Dere\GG13168-PA 926 GG13168-PA 523..625 440..550 224 39.6 Plus
Dere\GG13168-PA 926 GG13168-PA 573..658 434..519 223 43 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:43:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19280-PA 715 GH19280-PA 266..418 435..604 344 41.5 Plus
Dgri\GH17362-PA 563 GH17362-PA 171..316 436..598 322 41.4 Plus
Dgri\GH21844-PA 857 GH21844-PA 353..611 434..697 281 32.2 Plus
Dgri\GH10428-PA 799 GH10428-PA 295..555 437..698 275 29.4 Plus
Dgri\GH23129-PA 573 GH23129-PA 270..427 429..613 274 35.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:43:23
Subject Length Description Subject Range Query Range Score Percent Strand
Lin29-PA 1150 CG2052-PA 1..1150 1..1150 6123 100 Plus
Lin29-PC 1150 CG2052-PC 1..1150 1..1150 6123 100 Plus
Lin29-PB 1140 CG2052-PB 1..1140 1..1150 6053 99.1 Plus
Lin29-PD 791 CG2052-PD 8..791 367..1150 4177 99.7 Plus
rn-PC 692 CG42277-PC 43..419 203..609 358 28.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14055-PA 1110 GI14055-PA 258..685 331..796 1687 73.1 Plus
Dmoj\GI23490-PA 598 GI23490-PA 268..418 435..604 340 40.9 Plus
Dmoj\GI23901-PA 556 GI23901-PA 168..338 436..625 323 38.5 Plus
Dmoj\GI19087-PA 836 GI19087-PA 338..596 434..697 279 32.2 Plus
Dmoj\GI19253-PA 278 GI19253-PA 50..231 415..595 266 33 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:43:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18148-PA 921 GL18148-PA 2..921 205..1150 2718 67.8 Plus
Dper\GL12634-PA 550 GL12634-PA 179..349 436..625 331 39.5 Plus
Dper\GL26275-PA 880 GL26275-PA 427..715 426..719 296 29.1 Plus
Dper\GL12186-PA 535 GL12186-PA 281..376 435..530 291 52.1 Plus
Dper\GL14485-PA 197 GL14485-PA 8..111 437..550 269 45.6 Plus
Dper\GL26275-PA 880 GL26275-PA 719..851 421..553 255 41.1 Plus
Dper\GL26275-PA 880 GL26275-PA 505..813 420..743 253 25.4 Plus
Dper\GL26275-PA 880 GL26275-PA 481..727 424..695 247 28.9 Plus
Dper\GL26275-PA 880 GL26275-PA 135..250 426..549 242 39.5 Plus
Dper\GL26275-PA 880 GL26275-PA 161..270 424..541 241 40.7 Plus
Dper\GL26275-PA 880 GL26275-PA 118..285 437..628 222 29.7 Plus
Dper\GL26275-PA 880 GL26275-PA 189..275 424..512 198 41.6 Plus
Dper\GL26275-PA 880 GL26275-PA 385..685 440..738 195 25.6 Plus
Dper\GL26275-PA 880 GL26275-PA 381..631 464..721 185 27.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:43:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22510-PA 1014 GA22510-PA 38..1014 150..1150 2860 67.7 Plus
Dpse\GA26220-PB 726 GA26220-PB 283..435 435..604 346 41.5 Plus
Dpse\GA26220-PA 963 GA26220-PA 520..672 435..604 339 41.5 Plus
Dpse\GA26220-PC 971 GA26220-PC 528..680 435..604 339 41.5 Plus
Dpse\GA18968-PA 550 GA18968-PA 179..349 436..625 331 39.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:43:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26782-PA 1094 GM26782-PA 1..1094 57..1150 4817 95.6 Plus
Dsec\GM10491-PA 688 GM10491-PA 259..411 435..604 344 41.5 Plus
Dsec\GM26826-PA 535 GM26826-PA 160..329 437..625 316 38.1 Plus
Dsec\GM22079-PA 964 GM22079-PA 296..607 413..720 296 27.8 Plus
Dsec\GM22367-PA 309 GM22367-PA 168..292 422..558 269 38.7 Plus
Dsec\GM22079-PA 964 GM22079-PA 583..696 435..554 266 41 Plus
Dsec\GM22079-PA 964 GM22079-PA 560..662 440..550 224 39.6 Plus
Dsec\GM22079-PA 964 GM22079-PA 610..695 434..519 222 43 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24383-PA 475 GD24383-PA 1..399 1..399 1940 95.5 Plus
Dsim\GD24384-PA 1023 GD24384-PA 1..205 699..903 830 95.1 Plus
Dsim\GD19488-PA 943 GD19488-PA 513..665 435..604 342 41.5 Plus
Dsim\GD19275-PA 534 GD19275-PA 159..328 437..625 315 38.1 Plus
Dsim\GD23730-PA 750 GD23730-PA 176..497 366..687 277 27.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:43:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18239-PA 1062 GJ18239-PA 247..840 331..920 2153 75.8 Plus
Dvir\GJ10241-PA 703 GJ10241-PA 266..418 435..604 343 41.5 Plus
Dvir\GJ23994-PA 545 GJ23994-PA 163..333 436..625 325 38.5 Plus
Dvir\GJ20060-PA 838 GJ20060-PA 342..600 434..697 281 32.2 Plus
Dvir\GJ20712-PA 735 GJ20712-PA 279..568 437..719 275 28.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:44:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13709-PA 1054 GK13709-PA 260..862 325..922 2273 78.5 Plus
Dwil\GK11085-PA 731 GK11085-PA 280..432 435..604 346 41.5 Plus
Dwil\GK13799-PA 569 GK13799-PA 168..335 436..625 330 40.6 Plus
Dwil\GK14669-PA 673 GK14669-PA 255..532 416..698 294 28.7 Plus
Dwil\GK21553-PA 833 GK21553-PA 330..590 434..708 285 31.1 Plus
Dwil\GK14669-PA 673 GK14669-PA 401..570 397..570 216 28.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:44:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14516-PA 1091 GE14516-PA 1..1091 57..1150 4540 89.9 Plus
Dyak\GE25797-PA 943 GE25797-PA 519..671 435..604 344 41.5 Plus
Dyak\GE25586-PA 535 GE25586-PA 156..325 437..625 317 38.1 Plus
Dyak\GE14467-PA 502 GE14467-PA 199..412 417..642 282 33.1 Plus
Dyak\GE18486-PA 717 GE18486-PA 177..498 366..687 282 26.9 Plus

GH02610.hyp Sequence

Translation from 141 to 3593

> GH02610.hyp
MKLRCFNQAQTSHSWHPRSVFRVVSSCPPDRKKRPSPASWQICIGHLLTN
YLGMFKMDSADFWQQARAPFGLQTALHQYSSPPNQQPISHHALHHSVPQE
NEQLAGVQPEGPAAGSGVVGNNSSMAISGTNSTVGSKAESSHIPQQHSEQ
QSYGSDSFRGTQSPQLSSHHLLFNAAAAAAAAVHLKSTAMQNNLSPIGDQ
VQNNLRNYGQGSLNALCGIKPKQEMDAKTPLQPLDECPHPLVQAQAQSQY
GGDYYDVADPQAREISEGRALIIGLGAPSTVSTDDAQSSAPSHQLAGTGR
ALQTHQCKPMSPGTVGSSNLGAGRRSAPTTISKTFSQGQQSPQHSTTPSG
GSTTPDIKYNNDKMANEIQLQLSRSSSAAAISERTLEECWSTLQRLFMHK
SAMQQIQQQIPRVGLGTHGVTGSANLGGSITPSSDTKPHQCQQCMKSFSS
NHQLVQHIRVHTGEKPYKCSYCDRRFKQLSHVQQHTRLHTGERPYKCHLP
DCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKGFATESSLRTHT
SKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKEK
SPPPGGSASSQFSELNQIVTGNGNGTGSSNEQIATQCTTESNSHQATVGS
SLIDSFLGKRRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMW
PCSVCQAVFTHENGLLTHMESMRMDPKHQFAAQYVLSRAAAEQRERESLL
AVTLAASSGASTRIGIADAGNVLPTGAHNSDGSNSKCPSPSANSECSSNG
RLSSSTTSDQDQDIDHGLSENENSNQNNIGSSTNNNNNCTSNNNASSHKM
AELRLPGTGQYTMDAELHVANRMSLMAAAAAAVAASRPQDGVDTSAVPSA
AVQAAVVNLAAAMRMNNSSNGATPYQQHHADHTQAHQTHILQHAHPHHHQ
QQQAPQHQQQQLSHLLVHTHPSNSNSRSQSSPNINVPSLQNESTAASIAM
NMNVHMMRGSLDPDPSLGGMHGIEVLHQHQQQHHHHHHHHTSNYPQHAVT
PTNQHTHPHPQTHQTAHHHTSPETALRMHQAEAILRSHTEAAFRLATGSG
PDTGVKCEADQNQLNSNNAGNAGGNSGGNSQQHRFHASSNHQENQRPSDS
*

GH02610.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Lin29-PA 1150 CG2052-PA 1..1150 1..1150 6123 100 Plus
Lin29-PC 1150 CG2052-PC 1..1150 1..1150 6123 100 Plus
Lin29-PB 1140 CG2052-PB 1..1140 1..1150 6053 99.1 Plus
Lin29-PD 791 CG2052-PD 8..791 367..1150 4177 99.7 Plus
rn-PC 692 CG42277-PC 43..419 203..609 358 28.8 Plus