Clone GH02678 Report

Search the DGRC for GH02678

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:26
Well:78
Vector:pOT2
Associated Gene/TranscriptVps4-RA
Protein status:GH02678.pep: gold
Preliminary Size:2036
Sequenced Size:2072

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6842 2000-02-14 Blastp of sequenced clone
CG6842 2001-01-01 Release 2 assignment
CG6842 2003-01-01 Sim4 clustering to Release 3
CG6842 2008-04-29 Release 5.5 accounting
CG6842 2008-08-15 Release 5.9 accounting
CG6842 2008-12-18 5.12 accounting

Clone Sequence Records

GH02678.complete Sequence

2072 bp (2072 high quality bases) assembled on 2000-02-14

GenBank Submission: AF145606

> GH02678.complete
CGCTGTGGTCACACTGACAAATAAAAAAAAACAAGACGTCGTCATTCGCG
TTGGAATTCCAACAAAATAGTTAAGTTTTCCTTTTGTTTAACACCTGTCG
AGTTAGCCAGCGAGTTAGTCAGTGACGCTTGCCGGAATTCCAGGAGCAAG
TCAGCCAGCATAAATCACCATGGCAGCCGGTACCACACTACAGAAGGCCA
TCGATCTGGTGACCAAGGCCACCGAGGAGGATCGAAATAAGAACTACGCG
GAGGCACTGCGTCTGTATGAGCACGGGGTGGAGTACTTCCTGCACACCAT
CAAATATGAGGCACAGGGCGAGAAGGCCAAGGACTCGATACGGGCCAAGT
GCCTGCAGTATTTGGACCGGGCCGAGAAGCTAAAGGAGTACCTGAAGAAG
GGCAAAAAGAAACCGATCAAGGAGGGTGGTGAGTCCAGCGCCAAGGACGA
CAAGGACAAAAAGAGCGACAGCGATGACGAGGACGGCGACGATCCCGAGA
AGAAGAAGCTGCAGAGCAAGCTGGAGGACGCCATTGTCATAGAGAAGCCA
AAGGTTCAGTGGTCCGATGTCGCTGGCCTGGATGCCGCCAAGGAGGCGCT
GAAGGAGGCCGTTATCCTGCCGATTAAATTCCCGCAGCTCTTCACTGGCA
AGCGGATTCCGTGGAAGGGCATCCTGCTGTTCGGCCCGCCCGGTACCGGT
AAATCCTATCTGGCCAAGGCCGTCGCCACCGAGGCCAATCGCTCCACATT
CTTCTCGGTGTCCAGTTCGGATCTGATGTCCAAGTGGCTGGGCGAGTCCG
AGAAGCTGGTCAAGAATCTCTTCGAACTGGCCCGCCAGCACAAGCCCTCC
ATTATCTTCATTGACGAGATCGATTCGATGTGCTCGGCGAGATCGGACAA
CGAGAACGACAGCGTGCGACGCATCAAGACCGAGTTTCTGGTGCAGATGC
AGGGCGTGGGCAATGACACCGATGGCATTCTCGTTCTCGGCGCCACAAAC
ATACCGTGGGTCCTCGACTCGGCCATTCGCCGTCGATTCGAGAAGCGCAT
CTACATTCCGCTGCCGGAGGCGCATGCCCGCCTCGTCATGTTCAAGATCC
ATCTGGGCAACACCACGCACGTGCTCACCGAGCAGGATCTCAAGGAGTTG
GCCGGCAAAACCGAGGGCTACTCTGGCGCGGATATATCAATCGTTGTGCG
CGATGCGCTGATGGAACCCGTGAGGAAAGTGCAGACCGCCACGCATTTCA
AGCGGGTATCCGGTCCGAGTCCCACCAACCACGAGGAGATTGTCAACGAT
TTGCTGGTTCCGTGCTCACCTGGCGACCAGGGCGCCGTCGAGATGAACTG
GATGGATGTGCCCAGCGACAAGCTCTTCGAACCGCCCGTGACCATGCGCG
ACATGCTGAAGTCCTTGTCCCGCACGAAACCGACCGTCAACGAAGACGAT
CTGAAGAAGCTGCGCAAATTCACAGAGGACTTTGGGCAGGAGGGCTAGAC
ACGAACCCCGCCAGATATCGTCAGCACCACCAGCTAATTCTAATTGTTGC
CTATTGCATAAATTCAAACACGTTTTACTTCTGGCTCTCCTTAAACATTT
TTTTTATTTTATATATATATATAATGTATACATACGATATATGGTTAAAA
TTTAATTCAAATTTGTCGTTCGATTGCAACCGGAGATGAAGGACATGCAG
TGAGCGTGAAGCGGGTGGATCTGTGGATTGTTGTAATCACAAAGTCAATG
TATTTTTGTACTCTTAATGTTAAGCGACGGAAGAAACCCGATATCCAGCC
TGAAGTTTGAAACCTAATGTAATATGAGTGTCCGCCGCGCTTGCGCAATA
TTTGCCACTCGGACTTGCCACGGACACCTCAGATCAGAGCAGCACCAATC
AGCGGAGGAGCTGGAGCTAGAGCTGTAGAAGCAGAAGGAGAAGAAGGAGC
AGAAGCAGGAGCAGTTTGCGGAGTTTAAGCGCAGTCGAGCAAACCTATTT
AACTTGTAACGTACCAGAAATAAAAACGAAAATTGTAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA

GH02678.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
Vps4-RA 2584 Vps4-RA 102..2138 1..2037 10185 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 17798159..17799020 306..1167 4265 99.7 Plus
chrX 22417052 chrX 17799428..17800065 1396..2036 3030 98.9 Plus
chrX 22417052 chrX 17799131..17799360 1167..1396 1135 99.6 Plus
chrX 22417052 chrX 17797038..17797204 1..165 770 98.8 Plus
chrX 22417052 chrX 17797925..17798064 166..305 700 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Vps4-RB 1329 CG6842-PB 1..1329 170..1498 6645 100 Plus
Vps4-RA 1329 CG6842-PA 1..1329 170..1498 6645 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:28:20 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
Vps4-RB 2411 CG6842-RB 1..2031 6..2036 10155 100 Plus
Vps4-RA 2031 CG6842-RA 1..2031 6..2036 10155 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
Vps4-PB 442 CG6842-PB 1..442 170..1495 1992 100 Plus
Vps4-PA 442 CG6842-PA 1..442 170..1495 1992 100 Plus
Kat60-PA 572 CG10229-PA 279..570 521..1486 631 44.2 Plus
Kat60-PB 605 CG10229-PB 312..603 521..1486 631 44.2 Plus
kat-60L1-PF 605 CG1193-PF 308..603 509..1486 620 42.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17908808..17909669 306..1167 4310 100 Plus
X 23542271 X 17910077..17910718 1396..2037 3210 100 Plus
X 23542271 X 17909780..17910009 1167..1396 1150 100 Plus
X 23542271 X 17907687..17907851 1..165 825 100 Plus
X 23542271 X 17908574..17908713 166..305 700 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 17916906..17917767 306..1167 4310 100 Plus
X 23527363 X 17918175..17918816 1396..2037 3210 100 Plus
X 23527363 X 17917878..17918107 1167..1396 1150 100 Plus
X 23527363 X 17915785..17915949 1..165 825 100 Plus
X 23527363 X 17916672..17916811 166..305 700 100 Plus
Blast to na_te.dros performed 2014-11-26 21:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2309..2386 1886..1963 147 65.4 Plus
roo 9092 roo DM_ROO 9092bp 1062..1105 1921..1964 121 75 Plus

GH02678.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:36:29 Download gff for GH02678.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 17799429..17800065 1397..2036 94   Plus
chrX 17799132..17799360 1168..1396 99 -> Plus
chrX 17798159..17799020 306..1167 99 -> Plus
chrX 17797925..17798064 166..305 100 -> Plus
chrX 17797038..17797204 1..165 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:08:31 Download gff for GH02678.complete
Subject Subject Range Query Range Percent Splice Strand
CG6842-RA 1..1329 170..1498 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:41:28 Download gff for GH02678.complete
Subject Subject Range Query Range Percent Splice Strand
Vps4-RA 1..1329 170..1498 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:07:44 Download gff for GH02678.complete
Subject Subject Range Query Range Percent Splice Strand
Vps4-RA 1..1329 170..1498 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:19:48 Download gff for GH02678.complete
Subject Subject Range Query Range Percent Splice Strand
CG6842-RA 1..1329 170..1498 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:36:29 Download gff for GH02678.complete
Subject Subject Range Query Range Percent Splice Strand
Vps4-RA 1..1329 170..1498 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:47:25 Download gff for GH02678.complete
Subject Subject Range Query Range Percent Splice Strand
CG6842-RA 1..2036 1..2036 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:41:28 Download gff for GH02678.complete
Subject Subject Range Query Range Percent Splice Strand
Vps4-RA 1..2036 1..2036 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:07:44 Download gff for GH02678.complete
Subject Subject Range Query Range Percent Splice Strand
Vps4-RA 1..2031 6..2036 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:19:48 Download gff for GH02678.complete
Subject Subject Range Query Range Percent Splice Strand
CG6842-RA 1..2036 1..2036 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:29 Download gff for GH02678.complete
Subject Subject Range Query Range Percent Splice Strand
Vps4-RA 1..2031 6..2036 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:36:29 Download gff for GH02678.complete
Subject Subject Range Query Range Percent Splice Strand
X 17910078..17910717 1397..2036 100   Plus
X 17909781..17910009 1168..1396 100 -> Plus
X 17908808..17909669 306..1167 100 -> Plus
X 17908574..17908713 166..305 100 -> Plus
X 17907687..17907851 1..165 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:07:44 Download gff for GH02678.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17804111..17804750 1397..2036 100   Plus
arm_X 17803814..17804042 1168..1396 100 -> Plus
arm_X 17802841..17803702 306..1167 100 -> Plus
arm_X 17802607..17802746 166..305 100 -> Plus
arm_X 17801720..17801884 1..165 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:54:45 Download gff for GH02678.complete
Subject Subject Range Query Range Percent Splice Strand
X 17918176..17918815 1397..2036 100   Plus
X 17917879..17918107 1168..1396 100 -> Plus
X 17916906..17917767 306..1167 100 -> Plus
X 17916672..17916811 166..305 100 -> Plus
X 17915785..17915949 1..165 100 -> Plus

GH02678.pep Sequence

Translation from 169 to 1497

> GH02678.pep
MAAGTTLQKAIDLVTKATEEDRNKNYAEALRLYEHGVEYFLHTIKYEAQG
EKAKDSIRAKCLQYLDRAEKLKEYLKKGKKKPIKEGGESSAKDDKDKKSD
SDDEDGDDPEKKKLQSKLEDAIVIEKPKVQWSDVAGLDAAKEALKEAVIL
PIKFPQLFTGKRIPWKGILLFGPPGTGKSYLAKAVATEANRSTFFSVSSS
DLMSKWLGESEKLVKNLFELARQHKPSIIFIDEIDSMCSARSDNENDSVR
RIKTEFLVQMQGVGNDTDGILVLGATNIPWVLDSAIRRRFEKRIYIPLPE
AHARLVMFKIHLGNTTHVLTEQDLKELAGKTEGYSGADISIVVRDALMEP
VRKVQTATHFKRVSGPSPTNHEEIVNDLLVPCSPGDQGAVEMNWMDVPSD
KLFEPPVTMRDMLKSLSRTKPTVNEDDLKKLRKFTEDFGQEG*

GH02678.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 13:45:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19361-PA 442 GF19361-PA 1..442 1..442 2315 98.6 Plus
Dana\GF16351-PA 669 GF16351-PA 312..667 79..439 663 39 Plus
Dana\GF16069-PA 578 GF16069-PA 260..576 103..439 659 42.5 Plus
Dana\GF15688-PA 553 GF15688-PA 261..550 112..439 622 40.7 Plus
Dana\GF17034-PA 770 GF17034-PA 476..718 113..354 612 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 13:45:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19141-PA 442 GG19141-PA 1..442 1..442 2342 99.8 Plus
Dere\GG13037-PA 666 GG13037-PA 296..664 67..439 657 39.5 Plus
Dere\GG11155-PA 572 GG11155-PA 279..570 118..439 655 44.2 Plus
Dere\GG24448-PA 527 GG24448-PA 227..524 109..439 619 39.5 Plus
Dere\GG11247-PA 758 GG11247-PA 462..754 111..439 577 41.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 13:45:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18155-PA 607 GH18155-PA 314..605 118..439 677 44.2 Plus
Dgri\GH22753-PA 581 GH22753-PA 288..579 118..439 655 44.2 Plus
Dgri\GH18484-PA 782 GH18484-PA 486..778 111..439 613 41.7 Plus
Dgri\GH10474-PA 529 GH10474-PA 253..526 129..439 602 39.7 Plus
Dgri\GH24269-PA 522 GH24269-PA 192..470 85..352 498 37.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:45:33
Subject Length Description Subject Range Query Range Score Percent Strand
Vps4-PB 442 CG6842-PB 1..442 1..442 2273 100 Plus
Vps4-PA 442 CG6842-PA 1..442 1..442 2273 100 Plus
Kat60-PA 572 CG10229-PA 244..570 86..439 640 41.6 Plus
Kat60-PB 605 CG10229-PB 277..603 86..439 640 41.6 Plus
kat-60L1-PF 605 CG1193-PF 235..603 67..439 627 39 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 13:45:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14672-PA 442 GI14672-PA 1..442 1..442 2050 97.3 Plus
Dmoj\GI10108-PA 738 GI10108-PA 445..736 118..439 666 44.2 Plus
Dmoj\GI10218-PA 580 GI10218-PA 287..578 118..439 663 44.5 Plus
Dmoj\GI15929-PA 541 GI15929-PA 245..540 108..441 629 40.6 Plus
Dmoj\GI24145-PA 765 GI24145-PA 469..761 111..439 622 41.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 13:45:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22198-PA 582 GL22198-PA 289..580 118..439 657 44.2 Plus
Dper\GL24523-PA 677 GL24523-PA 320..675 79..439 646 39.6 Plus
Dper\GL19525-PA 551 GL19525-PA 185..548 48..439 638 37.3 Plus
Dper\GL23394-PA 788 GL23394-PA 492..736 111..354 595 48.4 Plus
Dper\GL25749-PA 387 GL25749-PA 95..332 122..358 419 39.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 13:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19899-PA 441 GA19899-PA 1..441 1..442 2002 94.8 Plus
Dpse\GA10173-PA 582 GA10173-PA 289..580 118..439 657 44.2 Plus
Dpse\GA30160-PA 610 GA30160-PA 253..608 79..439 647 39.6 Plus
Dpse\GA30160-PB 679 GA30160-PB 322..677 79..439 647 39.6 Plus
Dpse\GA17379-PA 563 GA17379-PA 197..560 48..439 637 37.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 13:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22866-PA 442 GM22866-PA 1..442 1..442 2345 100 Plus
Dsec\GM10656-PA 572 GM10656-PA 251..570 85..439 658 41.8 Plus
Dsec\GM10839-PA 711 GM10839-PA 418..709 118..439 655 43.6 Plus
Dsec\GM18154-PA 523 GM18154-PA 223..520 109..439 615 39.8 Plus
Dsec\GM26551-PA 758 GM26551-PA 462..754 111..439 577 41.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 13:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17375-PA 442 GD17375-PA 1..442 1..442 2345 100 Plus
Dsim\GD19637-PA 572 GD19637-PA 251..570 85..439 658 41.8 Plus
Dsim\GD19820-PA 668 GD19820-PA 298..666 67..439 656 39.5 Plus
Dsim\GD22765-PA 523 GD22765-PA 223..520 109..439 616 39.8 Plus
Dsim\GD21056-PA 758 GD21056-PA 462..754 111..439 571 41.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 13:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16581-PA 442 GJ16581-PA 1..442 1..442 2035 96.8 Plus
Dvir\GJ11019-PA 577 GJ11019-PA 284..575 118..439 660 44.2 Plus
Dvir\GJ23329-PA 607 GJ23329-PA 314..605 118..439 660 43.6 Plus
Dvir\GJ10403-PA 512 GJ10403-PA 236..509 129..439 623 41.3 Plus
Dvir\GJ24660-PA 769 GJ24660-PA 473..765 111..439 617 41.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 13:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15136-PA 442 GK15136-PA 1..442 1..442 2053 97.1 Plus
Dwil\GK14289-PA 574 GK14289-PA 255..572 102..439 659 42 Plus
Dwil\GK13431-PA 680 GK13431-PA 310..678 67..439 652 39.7 Plus
Dwil\GK11148-PA 777 GK11148-PA 481..773 111..439 629 42 Plus
Dwil\GK18355-PA 423 GK18355-PA 147..420 129..439 608 41.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 13:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17698-PA 442 GE17698-PA 1..442 1..442 2338 99.5 Plus
Dyak\GE10164-PA 672 GE10164-PA 302..670 67..439 658 39.5 Plus
Dyak\GE25304-PA 572 GE25304-PA 279..570 118..439 657 44.2 Plus
Dyak\GE14905-PA 526 GE14905-PA 226..523 109..439 620 39.8 Plus
Dyak\GE23439-PA 758 GE23439-PA 462..754 111..439 577 41.1 Plus

GH02678.hyp Sequence

Translation from 169 to 1497

> GH02678.hyp
MAAGTTLQKAIDLVTKATEEDRNKNYAEALRLYEHGVEYFLHTIKYEAQG
EKAKDSIRAKCLQYLDRAEKLKEYLKKGKKKPIKEGGESSAKDDKDKKSD
SDDEDGDDPEKKKLQSKLEDAIVIEKPKVQWSDVAGLDAAKEALKEAVIL
PIKFPQLFTGKRIPWKGILLFGPPGTGKSYLAKAVATEANRSTFFSVSSS
DLMSKWLGESEKLVKNLFELARQHKPSIIFIDEIDSMCSARSDNENDSVR
RIKTEFLVQMQGVGNDTDGILVLGATNIPWVLDSAIRRRFEKRIYIPLPE
AHARLVMFKIHLGNTTHVLTEQDLKELAGKTEGYSGADISIVVRDALMEP
VRKVQTATHFKRVSGPSPTNHEEIVNDLLVPCSPGDQGAVEMNWMDVPSD
KLFEPPVTMRDMLKSLSRTKPTVNEDDLKKLRKFTEDFGQEG*

GH02678.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
Vps4-PB 442 CG6842-PB 1..442 1..442 2273 100 Plus
Vps4-PA 442 CG6842-PA 1..442 1..442 2273 100 Plus
Kat60-PA 572 CG10229-PA 244..570 86..439 640 41.6 Plus
Kat60-PB 605 CG10229-PB 277..603 86..439 640 41.6 Plus
kat-60L1-PF 605 CG1193-PF 235..603 67..439 627 39 Plus