Clone GH03685 Report

Search the DGRC for GH03685

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:36
Well:85
Vector:pOT2
Associated Gene/TranscriptRab7-RA
Protein status:GH03685.pep: gold
Preliminary Size:2200
Sequenced Size:1513

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5915 2001-01-01 Release 2 assignment
CG5915 2001-09-19 Blastp of sequenced clone
CG5915 2003-01-01 Sim4 clustering to Release 3
Rab7 2008-04-29 Release 5.5 accounting
Rab7 2008-08-15 Release 5.9 accounting
Rab7 2008-12-18 5.12 accounting

Clone Sequence Records

GH03685.complete Sequence

1513 bp (1513 high quality bases) assembled on 2001-09-19

GenBank Submission: AY060236

> GH03685.complete
ATTCTCCTAGCGAGACAACAACAAAATTCACTGCGTAATTAATTGAATAT
TTTTTAGTAAAACCGAAGCGCCCCACAAAGAAACAGCTCTTGGAGTGTTC
ACCAGTGTTCAAACACCAAATACCAAAAGAAATAACCCCGAGTAAGCCAA
CGCCACAAACTGCATCGAAATGTCCGGACGTAAGAAATCCCTACTGAAAG
TCATCATTCTGGGCGACAGCAGTGTGGGCAAGACCTCTCTGATGAATCAG
TATGTAAACAAACGCTTCTCCAACCAATACAAAGCCACGATCGGAGCTGA
TTTCTGCACGAAAGAGGTGGTGGTCAACGACCGAGTGGTCACAATGCAGA
TCTGGGACACTGCTGGTCAGGAACGCTTCCAGTCGCTTGGAGTGGCGTTT
TACCGCGGAGCCGACTGCTGCGTGCTTGTCTACGATGTGACGGCGCCCAA
CTCGTTCAAGAATCTCGACTCCTGGCGCGACGAGTTCCTCATACAGGCCA
GTCCACGGGATCCCGATCACTTCCCCTTCGTTGTGTTGGGCAATAAGGTG
GATTTGGACAACCGCCAGGTGTCCACGCGTCGAGCGCAGCAATGGTGCCA
ATCTAAGAACGATATACCCTACTACGAAACGTCCGCCAAGGAGGGCATCA
ACGTGGAGATGGCGTTTCAAGTTATAGCCAAGAATGCGTTAGAGTTGGAG
GCGGAGGCTGAAGTTATCAACGATTTCCCCGATCAGATTACCTTGGGCTC
GCAAAACAATCGTCCTGGCAATCCTGACAACTGTCAGTGCTAATGTAACA
ACAACGCAAAATGGATAATTACACAATCTATATTATTAAATAATATTTCC
AACATAATAATGAACATGAGAAGCAAGCAACACAAAGGACGATAGAGGAA
GGTGTTATATGATTAAGTAAAACAATTTCAGCAAAACAGCATAGTAATTA
ATTAACTGATAGGATGCAAAGTTCAGATTCAGATCAACATCAGCTGAGTC
TTAACGAGCCTCTGGCAAAGGCTTAACCAGTATACCCACTTTCCTACGAC
CTAAGTAACCGTTCAATGAATAAGTATGCTCTGTGTACTCGTATTTAATA
ATTCATGTTTCTGACCGACCGCCCGCCTATCTCCCTAGTACTATTTTTGC
CATTGTATTAGTCAAATTTTGCACGCAACCGCTGCTGGCTTTTGCAACAG
AACAGCAACATTGAGAATACAACATCAGAGTATCTTCTAAACAAACAAAA
AATCTTGTGATTGTAAATTTAATAAAAGAATAACTTTTTAAATGTAATTT
ACAGACATAATTTCCTGCACCATCGAATTGGCTACTCTATTGTAATTGGC
TGAGCTCCACAAAACTTCTTTATGCATAACATTCGAGCGTGAATTTGGTT
TAGTTATAACGTTACTCGATATATCCTATAACTATGAATAGTATTCCATG
TAAAATTGCTCCTTGTTTTTGGTAATACATATATGTAAATTGTGTAAAAA
AAAAAAAAAAAAA

GH03685.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
Rab7-RA 1717 Rab7-RA 57..1552 1..1496 7480 100 Plus
Rab7.a 1727 Rab7.a 254..1636 114..1496 6915 100 Plus
Rab7.e 1674 Rab7.e 201..1583 114..1496 6915 100 Plus
Rab7.a 1727 Rab7.a 19..133 1..115 575 100 Plus
Rab7.e 1674 Rab7.e 19..133 1..115 575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:22:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19818059..19818849 705..1495 3955 100 Plus
chr3R 27901430 chr3R 19817640..19818000 347..707 1805 100 Plus
chr3R 27901430 chr3R 19817343..19817578 114..349 1180 100 Plus
chr3R 27901430 chr3R 19816403..19816516 1..113 505 98.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:22:00
Subject Length Description Subject Range Query Range Score Percent Strand
Rab7-RC 624 CG5915-PC 1..624 170..793 3120 100 Plus
Rab7-RB 624 CG5915-PB 1..624 170..793 3120 100 Plus
Rab7-RA 624 CG5915-PA 1..624 170..793 3120 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:30:04 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
Rab7-RA 1515 CG5915-RA 21..1515 1..1495 7475 100 Plus
Rab7-RC 1280 CG5915-RC 99..1280 114..1295 5910 100 Plus
Rab7-RB 1269 CG5915-RB 88..1269 114..1295 5910 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:22:02
Subject Length Description Subject Range Query Range Score Percent Strand
Rab7-PC 207 CG5915-PC 1..203 170..778 1013 100 Plus
Rab7-PB 207 CG5915-PB 1..203 170..778 1013 100 Plus
Rab7-PA 207 CG5915-PA 1..203 170..778 1013 100 Plus
Rab9-PA 256 CG9994-PA 8..171 179..667 377 47.3 Plus
Rab5-PI 219 CG3664-PI 23..215 173..772 325 38.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23994662..23995453 705..1496 3960 100 Plus
3R 32079331 3R 23994243..23994603 347..707 1805 100 Plus
3R 32079331 3R 23993946..23994181 114..349 1180 100 Plus
3R 32079331 3R 23993028..23993140 1..113 565 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23735493..23736284 705..1496 3960 100 Plus
3R 31820162 3R 23735074..23735434 347..707 1805 100 Plus
3R 31820162 3R 23734777..23735012 114..349 1180 100 Plus
3R 31820162 3R 23733859..23733971 1..113 565 100 Plus
Blast to na_te.dros performed on 2014-11-26 19:21:57 has no hits.

GH03685.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:08:25 Download gff for GH03685.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19818061..19818849 707..1495 100   Plus
chr3R 19817643..19817999 350..706 100 -> Plus
chr3R 19817343..19817578 114..349 100 -> Plus
chr3R 19816403..19816516 1..113 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:11:16 Download gff for GH03685.complete
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 1..624 170..793 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:58:52 Download gff for GH03685.complete
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 1..624 170..793 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:41:50 Download gff for GH03685.complete
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 1..624 170..793 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:42:06 Download gff for GH03685.complete
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 1..624 170..793 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:08:25 Download gff for GH03685.complete
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 1..624 170..793 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:13:38 Download gff for GH03685.complete
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 19..1513 1..1495 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:58:52 Download gff for GH03685.complete
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 19..1513 1..1495 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:41:50 Download gff for GH03685.complete
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 21..1515 1..1495 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:42:06 Download gff for GH03685.complete
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 19..1513 1..1495 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:08:25 Download gff for GH03685.complete
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 21..1515 1..1495 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:08:25 Download gff for GH03685.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23994664..23995452 707..1495 100   Plus
3R 23994246..23994602 350..706 100 -> Plus
3R 23993946..23994181 114..349 100 -> Plus
3R 23993028..23993140 1..113 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:41:50 Download gff for GH03685.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19820386..19821174 707..1495 100   Plus
arm_3R 19819968..19820324 350..706 100 -> Plus
arm_3R 19819668..19819903 114..349 100 -> Plus
arm_3R 19818750..19818862 1..113 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:25:21 Download gff for GH03685.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23735495..23736283 707..1495 100   Plus
3R 23735077..23735433 350..706 100 -> Plus
3R 23734777..23735012 114..349 100 -> Plus
3R 23733859..23733971 1..113 100 -> Plus

GH03685.pep Sequence

Translation from 169 to 792

> GH03685.pep
MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEV
VVNDRVVTMQIWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLD
SWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTRRAQQWCQSKNDIP
YYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNRPG
NPDNCQC*

GH03685.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17031-PA 207 GF17031-PA 1..207 1..207 1067 95.2 Plus
Dana\GF17026-PA 207 GF17026-PA 1..207 1..207 621 55.1 Plus
Dana\GF14043-PA 253 GF14043-PA 8..186 4..181 390 43.3 Plus
Dana\GF19340-PA 237 GF19340-PA 5..170 6..175 334 42.1 Plus
Dana\GF23429-PA 208 GF23429-PA 13..208 9..207 331 37.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:26:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11243-PA 207 GG11243-PA 1..207 1..207 1108 99.5 Plus
Dere\GG21181-PA 255 GG21181-PA 8..189 4..182 386 44.8 Plus
Dere\GG24527-PA 219 GG24527-PA 23..217 2..205 334 39 Plus
Dere\GG10272-PA 208 GG10272-PA 13..208 9..207 331 37.3 Plus
Dere\GG18360-PA 218 GG18360-PA 5..195 6..206 329 35.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:26:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18481-PA 207 GH18481-PA 1..207 1..207 1059 94.7 Plus
Dgri\GH13450-PA 266 GH13450-PA 8..188 4..181 391 44.5 Plus
Dgri\GH10191-PA 208 GH10191-PA 13..208 9..207 331 37.3 Plus
Dgri\GH24326-PA 201 GH24326-PA 1..199 1..205 330 36.6 Plus
Dgri\GH13785-PA 216 GH13785-PA 22..187 2..171 329 41.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
Rab7-PC 207 CG5915-PC 1..207 1..207 1091 100 Plus
Rab7-PB 207 CG5915-PB 1..207 1..207 1091 100 Plus
Rab7-PA 207 CG5915-PA 1..207 1..207 1091 100 Plus
Rab9-PA 256 CG9994-PA 8..186 4..181 382 45 Plus
Rab5-PI 219 CG3664-PI 23..217 2..205 331 39 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:26:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24142-PA 207 GI24142-PA 1..207 1..207 1054 94.2 Plus
Dmoj\GI14033-PA 264 GI14033-PA 9..188 5..181 391 44.8 Plus
Dmoj\GI16485-PA 228 GI16485-PA 11..228 8..207 348 36.7 Plus
Dmoj\GI14260-PA 208 GI14260-PA 13..208 9..207 330 37.3 Plus
Dmoj\GI17188-PA 216 GI17188-PA 22..187 2..171 329 41.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:26:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23391-PA 207 GL23391-PA 1..207 1..207 1076 96.6 Plus
Dper\GL21209-PA 259 GL21209-PA 8..189 4..182 393 44.3 Plus
Dper\GL14374-PA 230 GL14374-PA 11..179 8..175 335 41.9 Plus
Dper\GL18897-PA 208 GL18897-PA 13..208 9..207 331 37.3 Plus
Dper\GL19400-PA 218 GL19400-PA 22..216 2..205 329 39 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:26:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29225-PA 207 GA29225-PA 1..207 1..207 1076 96.6 Plus
Dpse\GA22174-PA 259 GA22174-PA 8..189 4..182 393 44.3 Plus
Dpse\GA13248-PA 230 GA13248-PA 11..179 8..175 335 41.9 Plus
Dpse\GA19714-PA 208 GA19714-PA 13..208 9..207 331 37.3 Plus
Dpse\GA17598-PA 218 GA17598-PA 22..216 2..205 329 39 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:26:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26547-PA 175 GM26547-PA 1..175 1..207 896 84.1 Plus
Dsec\GM17348-PA 255 GM17348-PA 8..189 4..182 382 44.3 Plus
Dsec\GM18235-PA 219 GM18235-PA 23..217 2..205 334 39 Plus
Dsec\GM26307-PA 208 GM26307-PA 13..208 9..207 331 37.3 Plus
Dsec\GM11275-PA 215 GM11275-PA 7..214 8..207 326 36.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24206-PA 255 GD24206-PA 8..189 4..182 383 44.8 Plus
Dsim\GD21052-PA 90 GD21052-PA 1..70 1..70 366 100 Plus
Dsim\GD22841-PA 219 GD22841-PA 23..217 2..205 334 39 Plus
Dsim\GD11278-PA 215 GD11278-PA 7..215 8..207 329 36.9 Plus
Dsim\GD10420-PA 213 GD10420-PA 6..196 8..202 323 35.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24655-PA 207 GJ24655-PA 1..207 1..207 1060 94.7 Plus
Dvir\GJ24657-PA 229 GJ24657-PA 1..229 1..207 659 57.3 Plus
Dvir\GJ16030-PA 226 GJ16030-PA 11..179 8..175 340 40.7 Plus
Dvir\GJ20647-PA 208 GJ20647-PA 13..208 9..207 331 37.3 Plus
Dvir\GJ22226-PA 216 GJ22226-PA 22..187 2..171 329 41.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14177-PA 207 GK14177-PA 1..207 1..207 1053 94.7 Plus
Dwil\GK18197-PA 261 GK18197-PA 8..199 4..192 407 43.5 Plus
Dwil\GK16937-PA 230 GK16937-PA 11..179 8..175 346 41.9 Plus
Dwil\GK21078-PA 208 GK21078-PA 13..208 9..207 331 37.3 Plus
Dwil\GK16335-PA 200 GK16335-PA 8..193 8..198 329 39.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23436-PA 207 GE23436-PA 1..207 1..207 1108 99.5 Plus
Dyak\GE13254-PA 260 GE13254-PA 8..189 4..182 386 44.8 Plus
Dyak\GE17848-PA 219 GE17848-PA 5..165 6..170 349 42.2 Plus
Dyak\GE15124-PA 219 GE15124-PA 23..217 2..205 334 39 Plus
Dyak\GE12402-PA 208 GE12402-PA 13..208 9..207 331 37.3 Plus

GH03685.hyp Sequence

Translation from 169 to 792

> GH03685.hyp
MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEV
VVNDRVVTMQIWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLD
SWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTRRAQQWCQSKNDIP
YYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNRPG
NPDNCQC*

GH03685.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
Rab7-PC 207 CG5915-PC 1..207 1..207 1091 100 Plus
Rab7-PB 207 CG5915-PB 1..207 1..207 1091 100 Plus
Rab7-PA 207 CG5915-PA 1..207 1..207 1091 100 Plus
Rab9-PA 256 CG9994-PA 8..186 4..181 382 45 Plus
Rab5-PI 219 CG3664-PI 23..217 2..205 331 39 Plus