Clone GH04704 Report

Search the DGRC for GH04704

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:47
Well:4
Vector:pOT2
Associated Gene/Transcriptslp1-RA
Protein status:GH04704.pep: gold
Preliminary Size:2200
Sequenced Size:1427

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16738 2001-01-01 Release 2 assignment
CG16738 2001-07-04 Blastp of sequenced clone
CG16738 2003-01-01 Sim4 clustering to Release 3
slp1 2008-04-29 Release 5.5 accounting
slp1 2008-08-15 Release 5.9 accounting
slp1 2008-12-18 5.12 accounting

Clone Sequence Records

GH04704.complete Sequence

1427 bp (1427 high quality bases) assembled on 2001-07-04

GenBank Submission: AY047536

> GH04704.complete
CTCAAGAGCAAACATCTCAAGCGATCCCAAGTCGTGTGTGAGAATCAGAA
ACCAAAGAAAACAAAAATCTAAAGATATCCGAATCAGAAAAATGGTGAAA
AGTGAAATGGAATTCAAGAGCAACTTCTCCATCGATGCCATCTTGGCCAA
GAAACCCATCAACACCGCAACTCAACCCATCAAAACCGAACCGGTGCATC
ATCATCATCAGTACGTTCATCCGTACTCCAATTCCGATGGCGAACTCTCG
GCTTCGGAGGATTTCGACAGCCCCAGCAGGACCAGCACACCCATGAGCAG
TGCCGCCGAGAGTCTATCGTCGCAAAACAATGACAAGCTCGACGTGGAGT
TCGACGATGAGCTGGAGGATCAGCTGGACGAGGACCAGGAGAGCGAGGAT
GGCAATCCCAGCAAGAAACAGAAAATGACCGCCGGCAGCGATACCAAGAA
ACCGCCATACAGCTACAACGCCCTCATCATGATGGCCATCCAGGATAGTC
CCGAGCAGCGGTTGACTTTGAATGGCATCTATCAGTATCTGATCAATAGA
TTCCCCTACTTCAAGGCCAACAAGCGGGGCTGGCAGAACTCCATTCGCCA
CAATCTGAGCCTGAACAAGTGCTTCACGAAGATTCCCCGCAGCTACGATG
ATCCCGGCAAGGGCAACTACTGGATCCTGGACCCCTCGGCCGAGGAGGTA
TTCATTGGCGAGACCACCGGCAAGCTGAGGCGCAAGAATCCCGGCGCCAG
TCGCACTCGCCTGGCCGCCTATCGTCAGGCCATATTCTCGCCGATGATGG
CTGCTTCACCATACGGAGCTCCAGCTTCCAGCTACGGATACCCGGCTGTT
CCATTCGCCGCCGCTGCCGCCGCCGCCCTGTACCAGCGCATGAATCCCGC
TGCCTATCAGGCTGCCTATCAGCAGATGCAGTACCAGCAGGCTCCTCAGG
CCCACCATCATCAGGCGCCCCATCCCGCCCAGATGCAGGGCTATCCACAA
CAATTGAACGCCGAGTTGTTTCAGCGCATGCAGTTCTTTGGCAAGTTTCC
ATCCAGCTAAATCTTGGCAGTCGGCGCAGAACCAAGCCCAGCGCTTTGGA
TCGAAAAAAAAAAACCCAGGGACAAAAGGGTCGCTTGGGGAAGAGCTAGG
ACTGGTAGGACTTCCTGCTCGCTTGCCCCGTGGAAAAACCCGTGACGTCT
AAATGCTGCATTTAGCAAATTCCTTTGGTCATCATCGCATTGACCGCTTC
GCTTCTTCAGCGGCTCCTCCGAATCGACTTGGAAAGTCGATGGTTAACGG
CAATGAATGCGCAGCCAAATCTTCAGGACTGCTGAAGAAGGATTCCTGCC
AGCCGAGAGCCCTTGTAGTTTGCTCACCAACTTTTGTACATATGTAATTA
GGAAATATAAAAAAAAAAAAAAAAAAA

GH04704.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
slp1-RA 1458 slp1-RA 14..1439 1..1427 7080 99.8 Plus
slp2.a 2300 slp2.a 1028..1115 643..730 230 84 Plus
slp2-RA 2360 slp2-RA 1088..1175 643..730 230 84 Plus
slp2.a 2300 slp2.a 843..916 458..531 160 81 Plus
slp2-RA 2360 slp2-RA 903..976 458..531 160 81 Plus
slp2.a 2300 slp2.a 953..1010 568..625 140 82.7 Plus
slp2-RA 2360 slp2-RA 1013..1070 568..625 140 82.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3825216..3826621 1..1408 6975 99.9 Plus
chr3L 24539361 chr3L 21464704..21464866 681..519 245 76.7 Minus
chr3L 24539361 chr3L 4019780..4019869 547..636 240 84.4 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:39:12
Subject Length Description Subject Range Query Range Score Percent Strand
slp1-RA 969 CG16738-PA 1..969 92..1060 4845 100 Plus
slp2-RA 1356 CG2939-PA 547..819 458..730 375 75.8 Plus
croc-RA 1527 CG5069-PA 278..440 519..681 245 76.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:31:45 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
slp1-RA 1425 CG16738-RA 19..1425 1..1408 6990 99.9 Plus
slp2-RA 2346 CG2939-RA 905..1177 458..730 375 75.8 Plus
croc-RA 2347 CG5069-RA 563..725 519..681 245 76.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:39:14
Subject Length Description Subject Range Query Range Score Percent Strand
slp1-PA 322 CG16738-PA 1..322 92..1057 1101 100 Plus
slp2-PA 451 CG2939-PA 169..291 401..784 471 66.4 Plus
fd19B-PA 260 CG9571-PA 46..154 410..739 334 56.4 Plus
croc-PA 508 CG5069-PA 70..165 449..736 320 58.3 Plus
fd64A-PB 365 CG1132-PB 90..195 446..754 309 54.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3825693..3827118 1..1427 7070 99.9 Plus
2L 23513712 2L 3837744..3838016 458..730 375 75.8 Plus
3L 28110227 3L 21475755..21475917 681..519 245 76.7 Minus
3L 28110227 3L 4020394..4020483 547..636 240 84.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:59:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3825693..3827118 1..1427 7080 99.8 Plus
3L 28103327 3L 4020394..4020483 547..636 240 84.4 Plus
2L 23513712 2L 3837929..3838016 643..730 230 84 Plus
3L 28103327 3L 21468911..21468968 625..568 215 91.3 Minus
2L 23513712 2L 3837744..3837817 458..531 160 81 Plus
2L 23513712 2L 3837854..3837911 568..625 140 82.7 Plus
Blast to na_te.dros performed on 2014-11-27 11:39:10 has no hits.

GH04704.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:29:53 Download gff for GH04704.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3825216..3826615 1..1402 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:15:05 Download gff for GH04704.complete
Subject Subject Range Query Range Percent Splice Strand
slp1-RA 1..969 92..1060 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:29:42 Download gff for GH04704.complete
Subject Subject Range Query Range Percent Splice Strand
slp1-RA 1..969 92..1060 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:09:01 Download gff for GH04704.complete
Subject Subject Range Query Range Percent Splice Strand
slp1-RA 1..969 92..1060 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:03:08 Download gff for GH04704.complete
Subject Subject Range Query Range Percent Splice Strand
slp1-RA 1..969 92..1060 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:29:53 Download gff for GH04704.complete
Subject Subject Range Query Range Percent Splice Strand
slp1-RA 1..969 92..1060 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:30:14 Download gff for GH04704.complete
Subject Subject Range Query Range Percent Splice Strand
slp1-RA 14..1420 1..1408 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:29:42 Download gff for GH04704.complete
Subject Subject Range Query Range Percent Splice Strand
slp1-RA 14..1420 1..1408 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:09:01 Download gff for GH04704.complete
Subject Subject Range Query Range Percent Splice Strand
slp1-RA 19..1425 1..1408 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:03:08 Download gff for GH04704.complete
Subject Subject Range Query Range Percent Splice Strand
slp1-RA 14..1420 1..1408 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:29:53 Download gff for GH04704.complete
Subject Subject Range Query Range Percent Splice Strand
slp1-RA 19..1425 1..1408 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:29:53 Download gff for GH04704.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3825693..3827099 1..1408 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:09:01 Download gff for GH04704.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3825693..3827099 1..1408 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:41:10 Download gff for GH04704.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3825693..3827099 1..1408 99   Plus

GH04704.hyp Sequence

Translation from 1 to 1059

> GH04704.hyp
SRANISSDPKSCVRIRNQRKQKSKDIRIRKMVKSEMEFKSNFSIDAILAK
KPINTATQPIKTEPVHHHHQYVHPYSNSDGELSASEDFDSPSRTSTPMSS
AAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKK
PPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRH
NLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGAS
RTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNPA
AYQAAYQQMQYQQAPQAHHHQAPHPAQMQGYPQQLNAELFQRMQFFGKFP
SS*

GH04704.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
slp1-PA 322 CG16738-PA 1..322 31..352 1702 100 Plus
slp2-PA 451 CG2939-PA 49..330 28..301 564 44 Plus
fd19B-PA 260 CG9571-PA 40..231 131..327 378 42.1 Plus
croc-PA 508 CG5069-PA 70..165 150..245 320 58.3 Plus
fd64A-PB 365 CG1132-PB 90..195 149..251 309 54.1 Plus

GH04704.pep Sequence

Translation from 91 to 1059

> GH04704.pep
MVKSEMEFKSNFSIDAILAKKPINTATQPIKTEPVHHHHQYVHPYSNSDG
ELSASEDFDSPSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQE
SEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYL
INRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSA
EEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMMAASPYGAPASSYGY
PAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQAHHHQAPHPAQMQG
YPQQLNAELFQRMQFFGKFPSS*

GH04704.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15038-PA 350 GF15038-PA 1..350 6..322 1300 80.6 Plus
Dana\GF15039-PA 470 GF15039-PA 174..343 96..271 534 58.3 Plus
Dana\GF23559-PA 508 GF23559-PA 70..154 120..204 328 63.5 Plus
Dana\GF13549-PA 456 GF13549-PA 78..171 120..215 312 58.3 Plus
Dana\GF25022-PA 371 GF25022-PA 90..181 119..204 311 58.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24971-PA 323 GG24971-PA 1..323 1..322 1446 96.9 Plus
Dere\GG24972-PA 452 GG24972-PA 151..330 85..271 545 57.1 Plus
Dere\GG18013-PA 250 GG18013-PA 50..146 120..216 342 59.8 Plus
Dere\GG13233-PA 507 GG13233-PA 67..154 117..204 328 61.4 Plus
Dere\GG15176-PA 364 GG15176-PA 90..181 119..204 315 59.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11193-PA 340 GH11193-PA 1..340 1..322 1099 73.8 Plus
Dgri\GH11194-PA 478 GH11194-PA 190..359 96..271 534 58.4 Plus
Dgri\GH12162-PA 368 GH12162-PA 22..217 53..244 388 42.1 Plus
Dgri\GH10748-PA 341 GH10748-PA 1..140 1..134 371 70.8 Plus
Dgri\GH15375-PA 508 GH15375-PA 70..154 120..204 328 63.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
slp1-PA 322 CG16738-PA 1..322 1..322 1702 100 Plus
slp2-PA 451 CG2939-PA 59..330 9..271 563 45 Plus
fd19B-PA 260 CG9571-PA 40..231 101..297 378 42.1 Plus
croc-PA 508 CG5069-PA 70..165 120..215 320 58.3 Plus
fd64A-PB 365 CG1132-PB 90..195 119..221 309 54.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18113-PA 342 GI18113-PA 1..342 1..322 1131 75.9 Plus
Dmoj\GI18115-PA 488 GI18115-PA 169..391 90..281 525 50 Plus
Dmoj\GI10909-PA 413 GI10909-PA 61..188 97..216 376 53.9 Plus
Dmoj\GI12979-PA 505 GI12979-PA 70..154 120..204 328 63.5 Plus
Dmoj\GI12553-PA 349 GI12553-PA 78..169 119..204 316 58.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18682-PA 342 GL18682-PA 1..342 1..322 1204 79.4 Plus
Dper\GL18683-PA 469 GL18683-PA 170..346 88..271 536 56.8 Plus
Dper\GL15821-PA 347 GL15821-PA 73..186 117..230 360 53.5 Plus
Dper\GL15055-PA 423 GL15055-PA 70..154 120..204 329 63.5 Plus
Dper\GL16060-PA 369 GL16060-PA 77..168 119..204 316 58.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14117-PA 347 GA14117-PA 1..347 1..322 1204 78.5 Plus
Dpse\GA15533-PA 471 GA15533-PA 172..348 88..271 538 56.8 Plus
Dpse\GA23375-PA 338 GA23375-PA 67..186 113..230 359 52.5 Plus
Dpse\GA18636-PA 523 GA18636-PA 70..154 120..204 327 63.5 Plus
Dpse\GA10915-PA 377 GA10915-PA 85..176 119..204 316 58.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:09:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18442-PA 322 GM18442-PA 1..322 1..322 1694 98.4 Plus
Dsec\GM18443-PA 450 GM18443-PA 111..329 49..271 546 50.9 Plus
Dsec\GM22695-PA 256 GM22695-PA 52..154 114..216 347 57.3 Plus
Dsec\GM22139-PA 507 GM22139-PA 70..154 120..204 328 63.5 Plus
Dsec\GM14607-PA 368 GM14607-PA 90..181 119..204 313 59.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23260-PA 322 GD23260-PA 1..322 1..322 1466 94.1 Plus
Dsim\GD15555-PA 254 GD15555-PA 50..152 114..216 348 57.3 Plus
Dsim\GD12117-PA 491 GD12117-PA 70..154 120..204 327 63.5 Plus
Dsim\GD13797-PA 368 GD13797-PA 90..181 119..204 312 59.8 Plus
Dsim\GD11717-PA 456 GD11717-PA 85..178 120..215 312 58.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16300-PA 343 GJ16300-PA 1..343 1..322 1100 74.8 Plus
Dvir\GJ16301-PA 466 GJ16301-PA 175..349 85..271 529 56 Plus
Dvir\GJ18555-PA 394 GJ18555-PA 49..255 97..300 378 45.9 Plus
Dvir\GJ13122-PA 508 GJ13122-PA 70..154 120..204 329 63.5 Plus
Dvir\GJ15456-PA 348 GJ15456-PA 84..175 119..204 315 59.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15483-PA 346 GK15483-PA 1..342 1..320 1007 69.6 Plus
Dwil\GK15484-PA 468 GK15484-PA 137..254 119..236 497 70.3 Plus
Dwil\GK25667-PA 343 GK25667-PA 53..173 93..214 372 52.5 Plus
Dwil\GK16995-PA 528 GK16995-PA 70..154 120..204 328 63.5 Plus
Dwil\GK20787-PA 467 GK20787-PA 60..172 101..215 321 52.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18262-PA 324 GE18262-PA 1..324 1..322 1430 93.2 Plus
Dyak\GE18263-PA 451 GE18263-PA 111..329 49..271 553 51.3 Plus
Dyak\GE17344-PA 269 GE17344-PA 47..209 112..282 358 44.3 Plus
Dyak\GE22970-PA 507 GE22970-PA 67..154 117..204 328 61.4 Plus
Dyak\GE21395-PA 362 GE21395-PA 90..181 119..204 315 59.8 Plus