Clone GH04905 Report

Search the DGRC for GH04905

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:49
Well:5
Vector:pOT2
Associated Gene/TranscriptCG1407-RB
Protein status:GH04905.pep: gold
Preliminary Size:2200
Sequenced Size:1852

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1407 2001-01-01 Release 2 assignment
CG1407 2001-10-10 Blastp of sequenced clone
CG1407 2003-01-01 Sim4 clustering to Release 3
CG1407 2008-04-29 Release 5.5 accounting
CG1407 2008-08-15 Release 5.9 accounting
CG1407 2008-12-18 5.12 accounting

Clone Sequence Records

GH04905.complete Sequence

1852 bp (1852 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060631

> GH04905.complete
CCAATTTGACAGCCAAAATTTAGTTGGTTTCATCTGAAAAAGCAAATTAA
CTGAGAAATACTACCGAAAATGTCGCAGCGATAAGGTGAAATAGGCACCT
GTCCGCCCAAAAGGGGAAGCAAGCAGCGGATAGCGTCAAAAAGCGTTTGT
TAACAGCTTGCGAAGTCAGTGAATCACTAAAAGATAAAGACATTGAATTG
GCCAGTGGAGCGACCGCTGGAGGAGCACCCACAATTGCAGACCCATCGAT
CGCCCCTAATCCGCTCCAGCTCCAGGTGGAGGTGACACCAACGCCCCGAG
ACACACGCGCCCTTGCCGAAGTGGTGGCCCACATAAATAGAATGGGTAAC
GACGATCATCGACGGCGGAAGACACCCTGCGGATTTTGTATGGCAGTCTT
CAAATGGATACCAGTGCTATTTATCACCGCGGTAATAGCTTGGTCCTATT
ACGCTTATGTGGTGGAGCTATGCATCCGCAACTCGGAGAACCGCATTGGT
ATGATCTTCATGCTTCTGTTCTACCACCTCTTCCTCACCCTGTTCATGTG
GTCGTACTGGCGCACCATAATGACCTCCGTAGGCCGAATACCAGATCAAT
GGAGGATACCGGATGAGGAAGTGTCGCGACTTTTCCGAGCCGACAGCCCG
GACACCCAGAAACGCATTCTTAACAACTTTGCGCGCGATTTGCCAGTAAC
GAATCGCACAATGAATGGTTCGGTGCGGTTCTGCGAAAAGTGCAAGATCA
TCAAGCCAGACCGAGCTCACCACTGTAGTGTGTGCAGTTGCTGCGTACTG
AAGATGGATCACCACTGCCCCTGGGTAAACAACTGCGTTAACTTTTACAA
CTACAAGTACTTCGTGTTGTTCCTGGGCTATGCTCTTGTCTACTGCCTGT
ATGTGGCTTTTACCTCGCTACACGACTTTGTCGAGTTCTGGAAGGTAGGT
GCAGGACAGCTAAATGCCAGTGGAATGGGTCGTTTTCACATCTTGTTCCT
GTTCTTCATTGCCATTATGTTTGCCATTAGTTTGGTGAGTTTATTTGGCT
ACCACATCTACCTTGTGCTGGTGAATCGCACGACATTGGAGTCGTTCAGG
GCTCCGATCTTCCGCGTTGGCGGCCCCGATAAGAATGGTTATAACTTGGG
GCGTTATGCCAATTTCTGCGAAGTATTTGGTGACGACTGGCAATACTGGT
TCCTGCCCGTGTTTTCGAGCTTTGGCGATGGCAAAACATTTCCGATTCGA
CATATGGAAGAGGACACGGAATCTTTGCTAGGATATCACAGCGATACGCG
CATCGAGTTGGAGGAGGACTTTCTGCCAGAGCCGCGATTTCAAGACTCGA
TTCCATAGCTAATCATGACCAGCGACAATGTAGCTACATATTACATTTAG
AGATTCAGTTGTGAAGCCTCCTTACGACATACATATACTTTCAGTGTGTA
AATAACAGAGGTACAGACAGTCCATCCTATAGGGACAACTAGGTTATTAT
GTTTAAGTTACGAATGAGTCGATAGACAATTGTAATGTATATGTATGTAA
GTGATAATGCGAAAAATGTTAGGAGATCAAAATCTTAATTCTTGCTTGGA
CATTCGAGTTTGAAATTTAAAATCGTATTAATTTAGTGTGTAAGGATAAA
GTTATTAGAACATTTCGAACAAAAGTATATGTCTATATAGGAATATAGCT
CGTTATAGCTCGCGTCAACAAAAAACAAAATAGTATACACGCTTAGTGGA
ATAACAAGAAAATCAAAAGCGAAACTTTAAGCAACACATACGGATCTGTA
TATTTACAAAAATAAAATTCCAACTATTCCCATTAAAAAAAAAAAAAAAA
AA

GH04905.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG1407-RB 2030 CG1407-RB 197..2030 1..1834 9170 100 Plus
CG1407-RC 2067 CG1407-RC 19..972 1..954 4770 100 Plus
CG1407.a 1869 CG1407.a 45..989 1..945 4725 100 Plus
CG1407.a 1869 CG1407.a 989..1869 954..1834 4405 100 Plus
CG1407-RC 2067 CG1407-RC 1132..1397 954..1219 1330 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 18:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5915972..5916588 1834..1218 3055 99.7 Minus
chr2R 21145070 chr2R 5919916..5920393 478..1 2375 99.8 Minus
chr2R 21145070 chr2R 5919107..5919355 954..706 1245 100 Minus
chr2R 21145070 chr2R 5918812..5918947 1089..954 680 100 Minus
chr2R 21145070 chr2R 5918613..5918743 1219..1089 655 100 Minus
chr2R 21145070 chr2R 5919738..5919859 599..478 610 100 Minus
chr2R 21145070 chr2R 5919547..5919653 706..600 535 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 18:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG1407-RD 1059 CG1407-PD 1..1059 342..1400 5295 100 Plus
CG1407-RB 1017 CG1407-PB 1..1017 342..1358 5085 100 Plus
CG1407-RA 1332 CG1407-PA 1..878 342..1219 4390 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:32:11 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 18:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG1407-RD 1857 CG1407-RD 24..1857 1..1834 9170 100 Plus
CG1407-RB 1857 CG1407-RB 24..1857 1..1834 9170 100 Plus
CG1407-RA 2238 CG1407-RA 24..1242 1..1219 6095 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:27:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG1407-PD 352 CG1407-PD 1..352 342..1397 1856 99.7 Plus
CG1407-PB 338 CG1407-PB 1..338 342..1355 1795 100 Plus
CG1407-PA 443 CG1407-PA 1..301 342..1244 1576 98.7 Plus
CG1407-PG 452 CG1407-PG 1..310 342..1244 1556 95.8 Plus
CG1407-PE 440 CG1407-PE 1..298 342..1244 1548 97.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 18:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10028441..10029059 1836..1218 3095 100 Minus
2R 25286936 2R 10032393..10032870 478..1 2390 100 Minus
2R 25286936 2R 10031579..10031827 954..706 1245 100 Minus
2R 25286936 2R 10031284..10031419 1089..954 680 100 Minus
2R 25286936 2R 10031085..10031215 1219..1089 655 100 Minus
2R 25286936 2R 10032214..10032335 599..478 610 100 Minus
2R 25286936 2R 10032019..10032125 706..600 535 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10029640..10030258 1836..1218 3095 100 Minus
2R 25260384 2R 10033592..10034069 478..1 2390 100 Minus
2R 25260384 2R 10032778..10033026 954..706 1245 100 Minus
2R 25260384 2R 10032483..10032618 1089..954 680 100 Minus
2R 25260384 2R 10032284..10032414 1219..1089 655 100 Minus
2R 25260384 2R 10033413..10033534 599..478 610 100 Minus
2R 25260384 2R 10033218..10033324 706..600 535 100 Minus
Blast to na_te.dros performed on 2014-11-26 18:27:12 has no hits.

GH04905.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:03:33 Download gff for GH04905.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5919917..5920393 1..477 99   Minus
chr2R 5919738..5919859 478..599 100 <- Minus
chr2R 5919547..5919653 600..706 100 <- Minus
chr2R 5919108..5919354 707..953 100 <- Minus
chr2R 5918812..5918947 954..1089 100 <- Minus
chr2R 5918613..5918742 1090..1219 100 <- Minus
chr2R 5915972..5916586 1220..1834 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:16:22 Download gff for GH04905.complete
Subject Subject Range Query Range Percent Splice Strand
CG1407-RB 1..1017 342..1358 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:55:43 Download gff for GH04905.complete
Subject Subject Range Query Range Percent Splice Strand
CG1407-RB 1..1017 342..1358 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:25:29 Download gff for GH04905.complete
Subject Subject Range Query Range Percent Splice Strand
CG1407-RD 1..1059 342..1400 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:24:51 Download gff for GH04905.complete
Subject Subject Range Query Range Percent Splice Strand
CG1407-RB 1..1017 342..1358 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:03:33 Download gff for GH04905.complete
Subject Subject Range Query Range Percent Splice Strand
CG1407-RD 1..1059 342..1400 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:41:32 Download gff for GH04905.complete
Subject Subject Range Query Range Percent Splice Strand
CG1407-RB 19..1852 1..1834 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:55:43 Download gff for GH04905.complete
Subject Subject Range Query Range Percent Splice Strand
CG1407-RB 19..1852 1..1834 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:25:29 Download gff for GH04905.complete
Subject Subject Range Query Range Percent Splice Strand
CG1407-RB 24..1857 1..1834 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:24:51 Download gff for GH04905.complete
Subject Subject Range Query Range Percent Splice Strand
CG1407-RB 19..1852 1..1834 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:03:33 Download gff for GH04905.complete
Subject Subject Range Query Range Percent Splice Strand
CG1407-RB 24..1857 1..1834 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:03:33 Download gff for GH04905.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10032394..10032870 1..477 100   Minus
2R 10032214..10032335 478..599 100 <- Minus
2R 10032019..10032125 600..706 100 <- Minus
2R 10031580..10031826 707..953 100 <- Minus
2R 10031284..10031419 954..1089 100 <- Minus
2R 10031085..10031214 1090..1219 100 <- Minus
2R 10028443..10029057 1220..1834 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:25:29 Download gff for GH04905.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5919899..5920375 1..477 100   Minus
arm_2R 5919719..5919840 478..599 100 <- Minus
arm_2R 5919524..5919630 600..706 100 <- Minus
arm_2R 5919085..5919331 707..953 100 <- Minus
arm_2R 5918789..5918924 954..1089 100 <- Minus
arm_2R 5918590..5918719 1090..1219 100 <- Minus
arm_2R 5915948..5916562 1220..1834 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:02:01 Download gff for GH04905.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10033593..10034069 1..477 100   Minus
2R 10033413..10033534 478..599 100 <- Minus
2R 10033218..10033324 600..706 100 <- Minus
2R 10032779..10033025 707..953 100 <- Minus
2R 10032483..10032618 954..1089 100 <- Minus
2R 10032284..10032413 1090..1219 100 <- Minus
2R 10029642..10030256 1220..1834 100 <- Minus

GH04905.pep Sequence

Translation from 341 to 1357

> GH04905.pep
MGNDDHRRRKTPCGFCMAVFKWIPVLFITAVIAWSYYAYVVELCIRNSEN
RIGMIFMLLFYHLFLTLFMWSYWRTIMTSVGRIPDQWRIPDEEVSRLFRA
DSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAHHCSVCSC
CVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLHDFVEFW
KVGAGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNRTTLE
SFRAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQYWFLPVFSSFGDGKTF
PIRHMEEDTESLLGYHSDTRIELEEDFLPEPRFQDSIP*

GH04905.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 03:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12009-PA 338 GF12009-PA 1..338 1..338 1734 94.1 Plus
Dana\GF13417-PA 344 GF13417-PA 8..328 4..326 652 38.4 Plus
Dana\GF13331-PA 295 GF13331-PA 125..278 131..289 249 37.4 Plus
Dana\GF24992-PA 740 GF24992-PA 77..280 69..276 249 31.7 Plus
Dana\GF14058-PA 275 GF14058-PA 5..258 10..292 227 25.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 03:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25240-PA 438 GG25240-PA 1..298 1..301 1572 96.3 Plus
Dere\GG22210-PA 341 GG22210-PA 11..300 8..304 638 41.7 Plus
Dere\GG13843-PA 745 GG13843-PA 77..280 69..276 251 32.1 Plus
Dere\GG25240-PA 438 GG25240-PA 392..438 292..338 250 97.9 Plus
Dere\GG22313-PA 293 GG22313-PA 34..276 10..289 247 27.4 Plus
Dere\GG10348-PA 276 GG10348-PA 5..259 10..292 235 25.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 03:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20289-PA 470 GH20289-PA 1..304 1..306 1404 82.4 Plus
Dgri\GH19831-PA 290 GH19831-PA 12..273 2..289 253 28.2 Plus
Dgri\GH16078-PA 741 GH16078-PA 77..280 69..276 249 31.7 Plus
Dgri\GH13330-PA 278 GH13330-PA 5..258 10..289 218 25.6 Plus
Dgri\GH20289-PA 470 GH20289-PA 425..468 294..337 214 88.6 Plus
Dgri\GH18968-PA 381 GH18968-PA 61..194 16..186 214 31 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 03:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG1407-PB 338 CG1407-PB 1..338 1..338 1869 100 Plus
CG1407-PD 352 CG1407-PD 1..338 1..338 1869 100 Plus
CG1407-PA 443 CG1407-PA 1..301 1..301 1650 98.7 Plus
CG1407-PG 452 CG1407-PG 1..310 1..301 1630 95.8 Plus
CG1407-PE 440 CG1407-PE 1..298 1..301 1622 97.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 03:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19459-PA 373 GI19459-PA 1..371 1..337 1490 74.3 Plus
Dmoj\GI20419-PA 290 GI20419-PA 13..273 2..289 252 27.6 Plus
Dmoj\GI12340-PA 735 GI12340-PA 77..272 69..276 246 31.8 Plus
Dmoj\GI17805-PA 277 GI17805-PA 5..260 10..292 223 24.1 Plus
Dmoj\GI23298-PA 381 GI23298-PA 135..196 127..188 214 54.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 03:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11511-PA 338 GL11511-PA 1..338 1..338 1653 88.2 Plus
Dper\GL17257-PA 341 GL17257-PA 38..337 11..311 724 46.9 Plus
Dper\GL20650-PA 286 GL20650-PA 11..269 2..289 251 27.6 Plus
Dper\GL19029-PA 275 GL19029-PA 5..258 10..292 238 27.6 Plus
Dper\GL23902-PA 381 GL23902-PA 135..201 127..193 212 53.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 03:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24755-PA 338 GA24755-PA 1..338 1..338 1653 88.2 Plus
Dpse\GA24148-PA 341 GA24148-PA 38..337 11..311 722 47.2 Plus
Dpse\GA24151-PA 341 GA24151-PA 38..337 11..311 722 46.9 Plus
Dpse\GA20978-PA 286 GA20978-PA 9..269 1..289 251 27.1 Plus
Dpse\GA19011-PA 820 GA19011-PA 88..291 69..276 248 31.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 03:34:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20560-PA 440 GM20560-PA 1..298 1..301 1587 97.3 Plus
Dsec\GM19998-PA 338 GM19998-PA 9..324 9..328 629 41.5 Plus
Dsec\GM24670-PA 1029 GM24670-PA 88..298 69..279 261 31.6 Plus
Dsec\GM20561-PA 58 GM20561-PA 3..58 283..338 251 82.1 Plus
Dsec\GM20103-PA 293 GM20103-PA 34..276 10..289 247 27.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 03:34:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD26013-PA 440 GD26013-PA 1..298 1..301 1585 97.3 Plus
Dsim\GD25489-PA 338 GD25489-PA 9..297 9..304 616 43.6 Plus
Dsim\GD10032-PA 58 GD10032-PA 3..58 283..338 256 83.9 Plus
Dsim\GD12736-PA 744 GD12736-PA 77..280 69..276 251 32.1 Plus
Dsim\GD25579-PA 293 GD25579-PA 123..276 131..289 246 36.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 03:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21210-PA 480 GJ21210-PA 1..297 1..300 1378 82 Plus
Dvir\GJ20091-PA 289 GJ20091-PA 12..272 2..289 246 27.9 Plus
Dvir\GJ12232-PA 761 GJ12232-PA 88..291 69..276 245 31.7 Plus
Dvir\GJ17630-PA 277 GJ17630-PA 5..260 10..292 224 24.5 Plus
Dvir\GJ21210-PA 480 GJ21210-PA 435..478 294..337 214 88.6 Plus
Dvir\GJ24153-PA 382 GJ24153-PA 135..201 127..193 212 52.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 03:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21953-PA 367 GK21953-PA 1..367 1..338 1583 80.1 Plus
Dwil\GK16977-PA 781 GK16977-PA 88..291 69..276 248 31.7 Plus
Dwil\GK22100-PA 291 GK22100-PA 121..274 131..289 247 37.4 Plus
Dwil\GK18372-PA 275 GK18372-PA 103..258 131..292 218 29.9 Plus
Dwil\GK11281-PA 381 GK11281-PA 126..196 118..188 216 50.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 03:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21863-PA 465 GE21863-PA 1..298 1..301 1580 97 Plus
Dyak\GE14207-PA 341 GE14207-PA 4..300 1..304 615 42.4 Plus
Dyak\GE20136-PA 743 GE20136-PA 77..280 69..276 251 32.1 Plus
Dyak\GE14111-PA 293 GE14111-PA 34..276 10..289 246 27.4 Plus
Dyak\GE21863-PA 465 GE21863-PA 421..465 294..338 244 100 Plus
Dyak\GE13229-PA 276 GE13229-PA 5..259 10..292 235 25.2 Plus

GH04905.hyp Sequence

Translation from 341 to 1357

> GH04905.hyp
MGNDDHRRRKTPCGFCMAVFKWIPVLFITAVIAWSYYAYVVELCIRNSEN
RIGMIFMLLFYHLFLTLFMWSYWRTIMTSVGRIPDQWRIPDEEVSRLFRA
DSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAHHCSVCSC
CVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLHDFVEFW
KVGAGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNRTTLE
SFRAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQYWFLPVFSSFGDGKTF
PIRHMEEDTESLLGYHSDTRIELEEDFLPEPRFQDSIP*

GH04905.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:47:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG1407-PB 338 CG1407-PB 1..338 1..338 1869 100 Plus
CG1407-PD 352 CG1407-PD 1..338 1..338 1869 100 Plus
CG1407-PA 443 CG1407-PA 1..301 1..301 1650 98.7 Plus
CG1407-PG 452 CG1407-PG 1..310 1..301 1630 95.8 Plus
CG1407-PE 440 CG1407-PE 1..298 1..301 1622 97.7 Plus