Clone GH04952 Report

Search the DGRC for GH04952

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:49
Well:52
Vector:pOT2
Associated Gene/Transcript7B2-RB
Protein status:GH04952.pep: gold
Sequenced Size:1047

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
7B2-RB 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

GH04952.complete Sequence

1047 bp assembled on 2010-11-23

GenBank Submission: BT125782.1

> GH04952.complete
GACGGTTGAAACCGCTTGGAATCGCAATATGTTGTTCCGTTCGCAAACCC
ATGTTTTTCCAGGTGTGTACATGATGGTGGCGATGCTCGTGGTCGCCTTG
AGTGGCTACCAGGTGCAGTCCTATAGCGCCAAGGATATTCTTGCCGATGT
CTTGATGACGGATCTGCTGAATCGCATGGACAAAGACATGCAGGTGGGCT
ATTACGACGTGGGCAACGAGGCAGCCGCTGGCTCCAAGGACAACGTGGAC
CTGGTCTCCCGGTCGGAGTACGCGAGGCTGTGTGACGGCGGAAGCGACTG
CATCCTGCAATCGGGCTCGGCATCGGGAGCTGCCTCCCATCCTTCGCTGC
GGGATGACGAGTTTCTGCAGCACAGTTCGCTGTGGGGTCACCAGTTCATC
TCCGGCGGAATGGGAGAGGGTCCCAACAGGTATCCCACTATAGTGAAGAA
CGACGCCGGCCTGCCTGCCTACTGCAACCCTCCTAATCCCTGCCCTGAGG
GCTACGACATGGAGACGCAAGGCGGCAGCTGCATTGTCGACTTCGAAAAC
ACGGCCATCTTCAGCCGGGAGTTCCAGGCCGCTCAGGACTGTACCTGCGA
CAACGAGCATATGTTCGACTGCTCGGAACAGGATAGTGCTGATGTGGGCG
GCGACAAGGGTGACCTGAACTCCGCCGTGGAGCAGTACATCATGCAGATG
GGCCAGGAGAACAGCCTGAACAACGTTAACAGCCTGGCTAAGAAGGCCGG
ATATCCTGTGATGCCCGATCCTCGGCTGGACGACGCGGTCATAAACCCGT
TCCTCCAGGGCGACCGCTTGCCCATAGCCGCCAAGAAGGGCAACCTTTTA
TTCCACTAAGGTAACTCGCTGATAACGCGAGCATACACGACGTTTCCATA
TGGGTGTCTAATACTATTATCTATCATAGCTGGTTATCAATGTTGTCCCG
CAAGCGATGTCTAGTAATGTTTCTACCCTTTCCCGAAAATAAAGTTATTC
GTATAGTACCAGGGCTCTAAGCCGAAAATAAAAAAAAAAAAAAAAAA

GH04952.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1202658..1203639 48..1029 4910 100 Plus
chr3R 27901430 chr3R 1202563..1202609 1..47 235 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
7B2-RB 831 CG1168-PB 1..831 29..859 4155 100 Plus
7B2-RA 816 CG1168-PA 20..816 63..859 3985 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
7B2-RB 1148 CG1168-RB 125..1148 1..1024 5120 100 Plus
7B2-RA 1133 CG1168-RA 125..1133 1..1024 4860 98.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
7B2-PB 276 CG1168-PB 1..276 29..856 1366 100 Plus
7B2-PA 271 CG1168-PA 1..271 29..856 1315 97.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:27:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5376999..5377981 48..1030 4915 100 Plus
3R 32079331 3R 5376904..5376950 1..47 235 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5117830..5118812 48..1030 4915 100 Plus
3R 31820162 3R 5117735..5117781 1..47 235 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:27:42 has no hits.

GH04952.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:51:26 Download gff for GH04952.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1202658..1203639 48..1029 100   Plus
chr3R 1202563..1202609 1..47 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-11-23 14:43:54 Download gff for GH04952.complete
Subject Subject Range Query Range Percent Splice Strand
7B2-RB 1..831 29..859 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:44:24 Download gff for GH04952.complete
Subject Subject Range Query Range Percent Splice Strand
7B2-RB 1..831 29..859 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:31:48 Download gff for GH04952.complete
Subject Subject Range Query Range Percent Splice Strand
7B2-RB 1..831 29..859 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:51:26 Download gff for GH04952.complete
Subject Subject Range Query Range Percent Splice Strand
7B2-RB 1..831 29..859 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-11-23 14:43:54 Download gff for GH04952.complete
Subject Subject Range Query Range Percent Splice Strand
7B2-RB 151..1178 1..1028 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:44:24 Download gff for GH04952.complete
Subject Subject Range Query Range Percent Splice Strand
7B2-RB 151..1178 1..1028 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:31:48 Download gff for GH04952.complete
Subject Subject Range Query Range Percent Splice Strand
7B2-RB 151..1178 1..1028 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:51:26 Download gff for GH04952.complete
Subject Subject Range Query Range Percent Splice Strand
7B2-RB 125..1148 1..1024 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:51:26 Download gff for GH04952.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5376999..5377980 48..1029 100   Plus
3R 5376904..5376950 1..47 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:31:48 Download gff for GH04952.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1202721..1203702 48..1029 100   Plus
arm_3R 1202626..1202672 1..47 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:51:35 Download gff for GH04952.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5117830..5118811 48..1029 100   Plus
3R 5117735..5117781 1..47 100 -> Plus

GH04952.hyp Sequence

Translation from 0 to 858

> GH04952.hyp
TVETAWNRNMLFRSQTHVFPGVYMMVAMLVVALSGYQVQSYSAKDILADV
LMTDLLNRMDKDMQVGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDC
ILQSGSASGAASHPSLRDDEFLQHSSLWGHQFISGGMGEGPNRYPTIVKN
DAGLPAYCNPPNPCPEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCD
NEHMFDCSEQDSADVGGDKGDLNSAVEQYIMQMGQENSLNNVNSLAKKAG
YPVMPDPRLDDAVINPFLQGDRLPIAAKKGNLLFH*

GH04952.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
7B2-PB 276 CG1168-PB 1..276 10..285 1468 100 Plus
7B2-PA 271 CG1168-PA 1..271 10..285 1417 97.8 Plus

GH04952.pep Sequence

Translation from 1 to 858

> GH04952.pep
TVETAWNRNMLFRSQTHVFPGVYMMVAMLVVALSGYQVQSYSAKDILADV
LMTDLLNRMDKDMQVGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDC
ILQSGSASGAASHPSLRDDEFLQHSSLWGHQFISGGMGEGPNRYPTIVKN
DAGLPAYCNPPNPCPEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCD
NEHMFDCSEQDSADVGGDKGDLNSAVEQYIMQMGQENSLNNVNSLAKKAG
YPVMPDPRLDDAVINPFLQGDRLPIAAKKGNLLFH*

GH04952.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 15:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17250-PA 272 GF17250-PA 5..272 19..285 1123 79.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 15:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12793-PA 269 GG12793-PA 1..269 10..285 1328 90.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 15:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17856-PA 275 GH17856-PA 27..275 37..285 830 65 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
7B2-PB 276 CG1168-PB 1..276 10..285 1468 100 Plus
7B2-PA 271 CG1168-PA 1..271 10..285 1417 97.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 15:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22550-PA 260 GI22550-PA 5..260 37..285 865 67 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 15:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21643-PA 270 GL21643-PA 1..270 10..285 1151 78.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 15:30:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26358-PA 270 GA26358-PA 1..270 10..285 1151 78.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 15:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10806-PA 271 GM10806-PA 1..271 10..285 1375 93.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 15:30:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19785-PA 273 GD19785-PA 1..215 10..229 1074 91.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 15:30:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11108-PA 279 GJ11108-PA 2..279 8..285 914 65.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 15:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11849-PA 275 GK11849-PA 1..275 10..285 855 64.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 15:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25466-PA 269 GE25466-PA 1..269 10..285 1284 91.7 Plus