Clone GH04989 Report

Search the DGRC for GH04989

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:49
Well:89
Vector:pOT2
Associated Gene/TranscriptCHOp24-RA
Protein status:GH04989.pep: gold
Preliminary Size:1300
Sequenced Size:1093

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3564 2001-01-01 Release 2 assignment
CG3564 2001-10-10 Blastp of sequenced clone
CG3564 2003-01-01 Sim4 clustering to Release 3
CHOp24 2008-04-29 Release 5.5 accounting
CHOp24 2008-08-15 Release 5.9 accounting
CHOp24 2008-12-18 5.12 accounting

Clone Sequence Records

GH04989.complete Sequence

1093 bp (1093 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060633

> GH04989.complete
GCTGCAGTGCGTTTAATAGCGATTAAAACCAGGCCAAAAGTACTAAGACA
AACGATGGAATCGACACTCGCCAAGGTGCTGCTCCTTGTGGGCAGCCTGC
TGATCCTGTGCCGCACCAGCCACGCCTTCATCGTCAGCGTGGACGCCCAC
AATGAGGAGTGCTTCTTCGAGAACGTCGAAGGCGGCACCAAGTTTGGCGT
CACCTTCGAGGTGATCGACGGTGGCTTCCTAGACGTGGACATCAAGATCA
GCGGCCCGGATAACCATGTGATGCACGAGAGCGAAAAGGAGTCGTCCGGC
AAGTACACCTTTGTGGCCCCCGCCAAGGGAACCTACACCGTGTGCTTCAA
CAACGAACGCAGCAGCATGACCCCCAAGCTGGTCATGTTCTCCATCGACG
TGGGTGACGCACCGCAACGTGCGCCCGGAGCACCCGGCGAGGAGGAGGTG
GGCCACACCAAGCTGGAGGACATGATTCGGGAGCTCTCCGGCACGCTGAC
CAGTGTCAAGCACGAACAGGAGTACATGCATGTGCGCGACAAGATCCATC
GTTCGGTGAACGAGAACACCAACTCGCGAGTGGTGCTGTGGTCCACCTTC
GAAGCCCTCGTCCTGGTCCTGATGACAGTGGGCCAGGTGTACTACCTGAA
ACGCTTCTTCGAGGTCAAGCGCGTCGTGTAATCCCGAGCGGAAAACCAGG
ATGGAAGTAGCAAAGGAAGGCGGCACACGAAGCTCTGGGGGAAATGTGTG
CGCAATGCGTTGCAGTCTCAGATTTAATTTAAATGATTAACATCCTTTTG
TAATTTAAATAAAATACCTTGTAAAAATTAATTAGTGCTTGAAAGTATGT
CGATCATGTTTCTGTTTCGAGAATTATTAACAGAGATTGCTATATTAGAG
AAATTAATATATATATTTTTTTTTAATTACCAAATATCTCTTAATGGAAA
CAGAACAGCAAATATTTTCAGACACACATTCAAGGGGGGAAGAGACACTT
GTGAACTTTCGAACTAAATTGATAAGAACCATTTGTTTTCTAATAAATGT
AGGTTGACAAGAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH04989.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:03:18
Subject Length Description Subject Range Query Range Score Percent Strand
CHOp24-RA 1327 CHOp24-RA 140..1206 1..1067 5320 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 22:38:06
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 4434784..4435315 532..1063 2645 99.8 Plus
chrX 22417052 chrX 4434094..4434432 196..534 1665 99.4 Plus
chrX 22417052 chrX 4433827..4434023 1..197 985 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:38:03
Subject Length Description Subject Range Query Range Score Percent Strand
CHOp24-RB 627 CG3564-PB 1..627 55..681 3135 100 Plus
CHOp24-RA 627 CG3564-PA 1..627 55..681 3135 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:32:22 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
CHOp24-RB 1172 CG3564-RB 42..1104 1..1063 5300 99.9 Plus
CHOp24-RA 1104 CG3564-RA 42..1104 1..1063 5300 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:38:04
Subject Length Description Subject Range Query Range Score Percent Strand
CHOp24-PB 208 CG3564-PB 1..208 55..678 999 100 Plus
CHOp24-PA 208 CG3564-PA 1..208 55..678 999 100 Plus
CG9308-PA 203 CG9308-PA 18..203 127..678 400 41.9 Plus
p24-1-PB 210 CG1967-PB 16..197 109..660 230 28.3 Plus
p24-1-PA 210 CG1967-PA 16..197 109..660 230 28.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:38:00
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4541907..4542442 532..1067 2665 99.8 Plus
X 23542271 X 4541216..4541554 196..534 1695 100 Plus
X 23542271 X 4540949..4541145 1..197 985 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 4550005..4550540 532..1067 2665 99.8 Plus
X 23527363 X 4549314..4549652 196..534 1695 100 Plus
X 23527363 X 4549047..4549243 1..197 985 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:38:01 has no hits.

GH04989.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 00:57:45 Download gff for GH04989.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 4434784..4435315 532..1063 94   Plus
chrX 4434095..4434429 197..531 99 -> Plus
chrX 4433827..4434022 1..196 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:16:56 Download gff for GH04989.complete
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 1..627 55..681 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:37:20 Download gff for GH04989.complete
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 1..627 55..681 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:52:49 Download gff for GH04989.complete
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 1..627 55..681 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:06:39 Download gff for GH04989.complete
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 1..627 55..681 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:57:45 Download gff for GH04989.complete
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 1..627 55..681 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:18:34 Download gff for GH04989.complete
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 40..1102 1..1063 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:37:20 Download gff for GH04989.complete
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 40..1102 1..1063 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:52:49 Download gff for GH04989.complete
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 42..1104 1..1063 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:06:40 Download gff for GH04989.complete
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 40..1102 1..1063 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:57:45 Download gff for GH04989.complete
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 42..1104 1..1063 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 00:57:45 Download gff for GH04989.complete
Subject Subject Range Query Range Percent Splice Strand
X 4541907..4542438 532..1063 99   Plus
X 4541217..4541551 197..531 100 -> Plus
X 4540949..4541144 1..196 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:52:49 Download gff for GH04989.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4435940..4436471 532..1063 99   Plus
arm_X 4435250..4435584 197..531 100 -> Plus
arm_X 4434982..4435177 1..196 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:42:12 Download gff for GH04989.complete
Subject Subject Range Query Range Percent Splice Strand
X 4550005..4550536 532..1063 99   Plus
X 4549315..4549649 197..531 100 -> Plus
X 4549047..4549242 1..196 100 -> Plus

GH04989.hyp Sequence

Translation from 1 to 680

> GH04989.hyp
AAVRLIAIKTRPKVLRQTMESTLAKVLLLVGSLLILCRTSHAFIVSVDAH
NEECFFENVEGGTKFGVTFEVIDGGFLDVDIKISGPDNHVMHESEKESSG
KYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDAPQRAPGAPGEEEV
GHTKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTF
EALVLVLMTVGQVYYLKRFFEVKRVV*

GH04989.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:49:16
Subject Length Description Subject Range Query Range Score Percent Strand
CHOp24-PB 208 CG3564-PB 1..208 19..226 1072 100 Plus
CHOp24-PA 208 CG3564-PA 1..208 19..226 1072 100 Plus
CG9308-PA 203 CG9308-PA 8..203 33..226 409 40.8 Plus
p24-1-PB 210 CG1967-PB 4..197 25..220 238 27 Plus
p24-1-PA 210 CG1967-PA 4..197 25..220 238 27 Plus

GH04989.pep Sequence

Translation from 54 to 680

> GH04989.pep
MESTLAKVLLLVGSLLILCRTSHAFIVSVDAHNEECFFENVEGGTKFGVT
FEVIDGGFLDVDIKISGPDNHVMHESEKESSGKYTFVAPAKGTYTVCFNN
ERSSMTPKLVMFSIDVGDAPQRAPGAPGEEEVGHTKLEDMIRELSGTLTS
VKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALVLVLMTVGQVYYLKR
FFEVKRVV*

GH04989.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:14:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19355-PA 208 GF19355-PA 19..208 19..208 984 96.8 Plus
Dana\GF13282-PA 207 GF13282-PA 16..207 19..208 443 43.2 Plus
Dana\GF19411-PA 226 GF19411-PA 32..217 19..206 262 31.1 Plus
Dana\GF16422-PA 206 GF16422-PA 1..205 5..208 181 23.6 Plus
Dana\GF14850-PA 230 GF14850-PA 38..217 34..202 180 22.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:14:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18710-PA 208 GG18710-PA 1..208 1..208 1083 98.1 Plus
Dere\GG22154-PA 203 GG22154-PA 8..203 15..208 444 42.3 Plus
Dere\GG18829-PA 210 GG18829-PA 4..201 7..206 262 27.7 Plus
Dere\GG11349-PA 206 GG11349-PA 1..205 5..208 182 23.6 Plus
Dere\GG17343-PA 216 GG17343-PA 10..216 16..208 175 24.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:15:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24063-PA 209 GH24063-PA 21..209 20..208 945 92.6 Plus
Dgri\GH20668-PA 203 GH20668-PA 8..203 15..208 462 44.4 Plus
Dgri\GH20543-PA 203 GH20543-PA 8..203 15..208 457 43.9 Plus
Dgri\GH25217-PA 203 GH25217-PA 8..203 15..208 453 43.9 Plus
Dgri\GH11947-PA 238 GH11947-PA 50..229 25..206 247 29.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:14:56
Subject Length Description Subject Range Query Range Score Percent Strand
CHOp24-PB 208 CG3564-PB 1..208 1..208 1072 100 Plus
CHOp24-PA 208 CG3564-PA 1..208 1..208 1072 100 Plus
CG9308-PA 203 CG9308-PA 8..203 15..208 409 40.8 Plus
p24-1-PB 210 CG1967-PB 4..197 7..202 238 27 Plus
p24-1-PA 210 CG1967-PA 4..197 7..202 238 27 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:15:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15191-PA 208 GI15191-PA 1..208 1..208 961 88 Plus
Dmoj\GI18814-PA 202 GI18814-PA 1..202 8..208 454 42.9 Plus
Dmoj\GI15363-PA 235 GI15363-PA 28..226 8..206 241 27.6 Plus
Dmoj\GI10144-PA 216 GI10144-PA 10..216 16..208 178 25.8 Plus
Dmoj\GI15674-PA 206 GI15674-PA 19..205 23..208 175 25.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19967-PA 208 GL19967-PA 1..208 1..208 984 90.9 Plus
Dper\GL16969-PA 204 GL16969-PA 11..204 17..208 456 43.8 Plus
Dper\GL20350-PA 221 GL20350-PA 33..212 25..206 248 29.9 Plus
Dper\GL12279-PA 216 GL12279-PA 31..216 35..208 174 25.8 Plus
Dper\GL19428-PA 226 GL19428-PA 27..213 27..202 169 26.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28584-PA 208 GA28584-PA 1..208 1..208 988 91.3 Plus
Dpse\GA21688-PA 204 GA21688-PA 11..204 17..208 456 43.8 Plus
Dpse\GA15160-PA 221 GA15160-PA 33..212 25..206 247 29.9 Plus
Dpse\GA17284-PA 216 GA17284-PA 31..216 35..208 177 26.3 Plus
Dpse\GA16477-PA 226 GA16477-PA 12..213 16..202 176 26.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12348-PA 208 GM12348-PA 1..208 1..208 1086 98.1 Plus
Dsec\GM15877-PA 203 GM15877-PA 8..203 15..208 431 40.8 Plus
Dsec\GM26230-PA 216 GM26230-PA 10..216 16..208 183 25.6 Plus
Dsec\GM13040-PA 159 GM13040-PA 4..117 7..120 176 29.8 Plus
Dsec\GM17092-PA 232 GM17092-PA 33..219 27..202 160 22.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16693-PA 208 GD16693-PA 1..208 1..208 1086 98.1 Plus
Dsim\GD15445-PA 203 GD15445-PA 8..203 15..208 437 41.3 Plus
Dsim\GD20772-PA 216 GD20772-PA 10..216 16..208 181 25.6 Plus
Dsim\GD21160-PA 206 GD21160-PA 1..205 5..208 180 23.6 Plus
Dsim\GD21836-PA 232 GD21836-PA 33..219 27..202 164 23 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14798-PA 208 GJ14798-PA 1..208 1..208 967 88.9 Plus
Dvir\GJ21840-PA 203 GJ21840-PA 14..203 21..208 432 43.2 Plus
Dvir\GJ16789-PA 246 GJ16789-PA 58..237 25..206 237 27.2 Plus
Dvir\GJ23362-PA 216 GJ23362-PA 10..216 16..208 178 25.8 Plus
Dvir\GJ14134-PA 206 GJ14134-PA 1..205 5..208 164 22.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14515-PA 299 GK14515-PA 115..299 24..208 945 94.6 Plus
Dwil\GK10123-PA 224 GK10123-PA 10..215 3..206 255 29 Plus
Dwil\GK12749-PA 216 GK12749-PA 10..216 16..208 179 25.6 Plus
Dwil\GK14360-PA 206 GK14360-PA 28..205 32..208 155 23.2 Plus
Dwil\GK17263-PA 241 GK17263-PA 52..234 25..205 150 22.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16348-PA 208 GE16348-PA 1..208 1..208 1073 97.1 Plus
Dyak\GE12235-PA 203 GE12235-PA 1..203 5..208 436 40.3 Plus
Dyak\GE17592-PA 210 GE17592-PA 4..201 7..206 262 28.2 Plus
Dyak\GE23545-PA 206 GE23545-PA 1..205 5..208 182 23.6 Plus
Dyak\GE24749-PA 216 GE24749-PA 10..216 16..208 175 24.6 Plus