Clone GH05001 Report

Search the DGRC for GH05001

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:50
Well:1
Vector:pOT2
Associated Gene/TranscriptRip11-RB
Protein status:GH05001.pep: gold
Sequenced Size:2261

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6606 2003-01-01 Sim4 clustering to Release 3
l(1)G0003 2008-04-29 Release 5.5 accounting
l(1)G0003 2008-08-15 Release 5.9 accounting
Rip11 2008-12-18 5.12 accounting

Clone Sequence Records

GH05001.complete Sequence

2261 bp (2261 high quality bases) assembled on 2005-07-22

GenBank Submission: BT023794

> GH05001.complete
GCCACCTTTCAAACAACAACATCACGCGTCGCGTCTCCGTCTTTTTCCTT
TTTTTTTTTACATTAGACTACACTACGTTCTCCTGGCGTTTCGTTCGTGT
CGCGCGTGATTAAATTGGCAACTGAGAACAATAAGAAGAAATCACAGTGT
GCGAGCAGCAACAAACACAACGATTAGTGTAAACAAAACACATCGACAAC
AACAATCCAAATTACAATATAGGCAAAGAAGAAGAAACGAAAGGCAGGAC
CTTCGCAGCAAGAGCGAGACAGCAAAGGATCGGGATCGGGAGAGAGCGTG
AGAGTGCGACTTGATCAACGGGATACAGGGTGACATGTGGAGTCCGACGC
ACTGTAGTGTAACGGTGCAGCGAGCGCGTGGGCTGCTCACCAAGGGCAAG
AATGGCACCAACAACTGCTTCGTCACCATTGCTCTGGGCAAGGAGAAGTA
CCAGACGTCCGTCAAGGACAAGGCCGAGACGAGCGTCAACTGGAACGAGG
AGTGCGAACTGAAAATTCCCGATCAGGGTAATCGCGCCGAGCTCACTTTG
ACCTGCCTGCACAGGAACAATCTGGGCATCGATGAGTTCCTCGGCCAGGC
GACGCTGCCGCTCAACGAGATGGATGTGTATGACCGGCCACGCGCCAAGT
GGTTCAAGCTGGAGAGCAAGCCCGGCAAGGAGAAGAAGAACAAGGAGCGG
GGCGAGCTGGAGGTGCGCATCGCCTTCGTGGTCAAGTCCGGCTCGCTGAC
CGATCTCAGCAAGAAGGACAAGCACAAGTCTTCCATTGGCCAGCTGGCCA
GCTCCGTGGGTGGCAGTCTGTTGTCCATCGGCAACGGCGAGAAGCGGCGA
GGCATCAAGAAGCTGGCTGGCTCGCTTAGCTCTAAGCTGCACATCCGTAG
CAAGAAGAAGAACCAGGAGGCGGGCGCCGACGATAGTAGCTCCTTCGGCG
GCTCCTTCGCCAGCCTGGGCACGCCCAACAGCTCCAACGGCAGGGGCCAG
AATGGTGGCAGTGGCAGGCGACGTGGCGGCCAGCGGGCGGGCGAAGCCGA
TCCCGGCGTGATCAGCGAGGACGAGGACGAGTTTGTGTTCGACAACCTCT
CGCACAAGAGCTCCGGCAGCTCACTTAACATCCAACGCATCGGCCTGCAG
CCGCCGCCAGTCGGTACGCCCAACTTTACGCCGCGCCACCCATCGCCCCT
GCTGAACAACGGAGTTAGTGGCGTCGGAAGCGGCAGCGCGAAAGATAAAT
ACAACAACGACAACGACAGCAACTCGCCCAGTCCCAAGTCTACGGAGCGC
ATCATAATTGGTCACGAGAAGTCGGGATCGCATGCGGATCGCCGCTCGGA
GATATCCGCCCAGCTGGCCAAGAAATACGAGGGCAAGTCGCGCGAGGAAC
TAATGCTAATTGCCAACGGAATGGAGAACGAGGCTCTGCTGCAGCGGCAG
CGCGTGAAGGAGCTGGAAGACTATCTGGACAACCTGCTGCTGCGCGTGAT
GGAGACGCACCCGAAGATCCTGCAGAATCCGTATTCGCGCACCACGTCCG
CCAAGAGCGGCTAAACAAACAGCCAAACTGGCCGTCGCCAGCAACCGGTT
CACTTGTCGCAGAGCAGCTGGAGAAGATCTGCGGAGGTTGCTCCGGAAGC
TGTTGGGTCGAAACGAATCGAAACACCACGTTGCCTTTGCCGCGAACAGC
AAAATTCAAGTGCTTTCTAAAACGTATTGCTAAGAGGGAAACTAAGTGCA
CGCGTAAAACAGTTAGGCTTAAGGAGTGCAAAATCTATATTGATATTTTA
TTGTGTGTAGCATTCGTACTTTTTCGGTTAGAAATTCCCCTCCCCCCCAC
ACACACACACACTAAACAGAACTAAATTTGTTGTACTATATGTTTATCCT
GGCAATTGAAGCGATTTGTCGTGTTGCGAGTCCTTGTCAATTGATTGAAA
TTATCCGAAAGTATTGTGTTTGTTTTTTTGTATGACCCATTTTTTTTTTT
AGTATTGTGCGACAAGAGTTTGAGAAGTTTCTGTAAAGTGCTGCCTGGGA
AGTGGCCTTAGTGAATTAAGTCTTAAATTATTTATGTTTTAGCGGTTAAG
CGAAAAGTGGGAAAGGGGGACCATCCACGTATGTCCCCCGTGAAAAAAAG
AACACCACACACAGTTGAAATATGTTGATACTACAATGATTTTACTTATT
GATATAAACGCAAGCAAAATAAAAACATTTTTAACATAAATAAAAAAAAA
AAAAAAAAAAA

GH05001.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:32:47
Subject Length Description Subject Range Query Range Score Percent Strand
Rip11-RB 2356 Rip11-RB 117..2356 1..2240 11200 100 Plus
Rip11.a 3815 Rip11.a 95..1342 1..1248 6225 99.9 Plus
Rip11-RA 3839 Rip11-RA 40..1287 1..1248 6225 99.9 Plus
Rip11.a 3815 Rip11.a 3130..3815 1558..2243 3430 100 Plus
Rip11-RA 3839 Rip11-RA 3157..3839 1558..2240 3415 100 Plus
Rip11.a 3815 Rip11.a 2555..2869 1243..1557 1575 100 Plus
Rip11-RA 3839 Rip11-RA 2500..2814 1243..1557 1575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 18:29:45
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18528639..18529376 1248..511 3645 99.6 Minus
chrX 22417052 chrX 18524799..18525484 2241..1556 3415 99.9 Minus
chrX 22417052 chrX 18536357..18536721 365..1 1825 100 Minus
chrX 22417052 chrX 18526577..18526739 1557..1395 815 100 Minus
chrX 22417052 chrX 18526798..18526952 1397..1243 745 98.7 Minus
chrX 22417052 chrX 18529437..18529590 518..365 740 98.7 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 18:29:41
Subject Length Description Subject Range Query Range Score Percent Strand
Rip11-RB 1230 CG6606-PB 1..1230 335..1564 6150 100 Plus
Rip11-RC 1263 CG6606-PC 1..1223 335..1557 6115 100 Plus
Rip11-RE 2448 CG6606-PE 1..914 335..1248 4555 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:32:23 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 18:29:40
Subject Length Description Subject Range Query Range Score Percent Strand
Rip11-RB 2329 CG6606-RB 95..2329 1..2235 11175 100 Plus
Rip11-RC 2508 CG6606-RC 14..1570 1..1557 7785 100 Plus
Rip11-RE 3466 CG6606-RE 14..1261 1..1248 6225 99.9 Plus
Rip11-RC 2508 CG6606-RC 1831..2508 1558..2235 3390 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:29:43
Subject Length Description Subject Range Query Range Score Percent Strand
Rip11-PB 409 CG6606-PB 1..409 335..1561 1731 100 Plus
Rip11-PC 420 CG6606-PC 1..408 335..1558 1725 100 Plus
Rip11-PE 815 CG6606-PE 1..292 335..1210 1305 100 Plus
Rip11-PD 826 CG6606-PD 1..292 335..1210 1305 100 Plus
Rip11-PA 832 CG6606-PA 1..292 335..1210 1305 100 Plus
Rip11-PE 815 CG6606-PE 726..815 1292..1561 448 100 Plus
Rip11-PD 826 CG6606-PD 726..814 1292..1558 442 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 18:29:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18639460..18640197 1248..511 3675 99.9 Minus
X 23542271 X 18635634..18636321 2243..1556 3440 100 Minus
X 23542271 X 18647190..18647554 365..1 1825 100 Minus
X 23542271 X 18637413..18637575 1557..1395 815 100 Minus
X 23542271 X 18637634..18637788 1397..1243 775 100 Minus
X 23542271 X 18640258..18640411 518..365 740 98.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18647558..18648295 1248..511 3675 99.8 Minus
X 23527363 X 18643732..18644419 2243..1556 3440 100 Minus
X 23527363 X 18655288..18655652 365..1 1825 100 Minus
X 23527363 X 18645511..18645673 1557..1395 815 100 Minus
X 23527363 X 18645732..18645886 1397..1243 775 100 Minus
X 23527363 X 18648356..18648509 518..365 740 98.7 Minus
Blast to na_te.dros performed 2014-11-26 18:29:38
Subject Length Description Subject Range Query Range Score Percent Strand
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 103..177 2166..2239 120 65.8 Plus
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 1560..1634 2239..2166 120 65.8 Minus
rover 7318 rover ROVER 7318bp 1260..1298 1241..1279 114 76.9 Plus

GH05001.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:04:24 Download gff for GH05001.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18536357..18536721 1..365 100   Minus
chrX 18529445..18529589 366..510 100 <- Minus
chrX 18528643..18529376 511..1244 99 <- Minus
chrX 18526799..18526950 1245..1396 98 <- Minus
chrX 18526577..18526737 1397..1557 100 <- Minus
chrX 18524799..18525482 1558..2241 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:39:22 Download gff for GH05001.complete
Subject Subject Range Query Range Percent Splice Strand
Rip11-RA 1..910 335..1244 100 -> Plus
Rip11-RA 2129..2444 1245..1563 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:56:24 Download gff for GH05001.complete
Subject Subject Range Query Range Percent Splice Strand
Rip11-RB 1..1230 335..1564 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:26:30 Download gff for GH05001.complete
Subject Subject Range Query Range Percent Splice Strand
Rip11-RB 1..1230 335..1564 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:37:07 Download gff for GH05001.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0003-RA 1..910 335..1244 100 -> Plus
l(1)G0003-RA 2129..2444 1245..1563 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:04:24 Download gff for GH05001.complete
Subject Subject Range Query Range Percent Splice Strand
Rip11-RB 1..1230 335..1564 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:39:22 Download gff for GH05001.complete
Subject Subject Range Query Range Percent Splice Strand
Rip11-RA 10..1253 1..1244 100 -> Plus
Rip11-RA 2472..2784 1245..1557 100 -> Plus
Rip11-RA 3127..3810 1558..2241 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:56:23 Download gff for GH05001.complete
Subject Subject Range Query Range Percent Splice Strand
Rip11-RB 10..2244 1..2235 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:26:30 Download gff for GH05001.complete
Subject Subject Range Query Range Percent Splice Strand
Rip11-RB 14..2248 1..2235 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:37:07 Download gff for GH05001.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0003-RA 2472..2784 1245..1557 100 -> Plus
l(1)G0003-RA 10..1253 1..1244 100 -> Plus
l(1)G0003-RA 3127..3810 1558..2241 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:04:24 Download gff for GH05001.complete
Subject Subject Range Query Range Percent Splice Strand
Rip11-RB 95..2329 1..2235 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:04:24 Download gff for GH05001.complete
Subject Subject Range Query Range Percent Splice Strand
X 18647190..18647554 1..365 100   Minus
X 18640266..18640410 366..510 100 <- Minus
X 18639464..18640197 511..1244 100 <- Minus
X 18637635..18637786 1245..1396 100 <- Minus
X 18637413..18637573 1397..1557 100 <- Minus
X 18635636..18636319 1558..2241 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:26:30 Download gff for GH05001.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18541223..18541587 1..365 100   Minus
arm_X 18534299..18534443 366..510 100 <- Minus
arm_X 18533497..18534230 511..1244 100 <- Minus
arm_X 18531668..18531819 1245..1396 100 <- Minus
arm_X 18531446..18531606 1397..1557 100 <- Minus
arm_X 18529669..18530352 1558..2241 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:15:44 Download gff for GH05001.complete
Subject Subject Range Query Range Percent Splice Strand
X 18655288..18655652 1..365 100   Minus
X 18648364..18648508 366..510 100 <- Minus
X 18647562..18648295 511..1244 100 <- Minus
X 18645733..18645884 1245..1396 100 <- Minus
X 18645511..18645671 1397..1557 100 <- Minus
X 18643734..18644417 1558..2241 100 <- Minus

GH05001.pep Sequence

Translation from 334 to 1563

> GH05001.pep
MWSPTHCSVTVQRARGLLTKGKNGTNNCFVTIALGKEKYQTSVKDKAETS
VNWNEECELKIPDQGNRAELTLTCLHRNNLGIDEFLGQATLPLNEMDVYD
RPRAKWFKLESKPGKEKKNKERGELEVRIAFVVKSGSLTDLSKKDKHKSS
IGQLASSVGGSLLSIGNGEKRRGIKKLAGSLSSKLHIRSKKKNQEAGADD
SSSFGGSFASLGTPNSSNGRGQNGGSGRRRGGQRAGEADPGVISEDEDEF
VFDNLSHKSSGSSLNIQRIGLQPPPVGTPNFTPRHPSPLLNNGVSGVGSG
SAKDKYNNDNDSNSPSPKSTERIIIGHEKSGSHADRRSEISAQLAKKYEG
KSREELMLIANGMENEALLQRQRVKELEDYLDNLLLRVMETHPKILQNPY
SRTTSAKSG*

GH05001.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 23:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22404-PA 882 GF22404-PA 1..303 1..305 1309 92.5 Plus
Dana\GF22404-PA 882 GF22404-PA 756..863 300..407 537 94.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 23:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18106-PA 828 GG18106-PA 1..292 1..292 1411 98.3 Plus
Dere\GG18106-PA 828 GG18106-PA 705..809 303..407 542 98.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 23:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12810-PA 874 GH12810-PA 1..293 1..290 1185 87.1 Plus
Dgri\GH12810-PA 874 GH12810-PA 767..873 300..407 510 92.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
Rip11-PB 409 CG6606-PB 1..409 1..409 2111 100 Plus
Rip11-PC 420 CG6606-PC 1..408 1..408 2105 100 Plus
Rip11-PE 815 CG6606-PE 1..305 1..305 1578 99.7 Plus
Rip11-PD 826 CG6606-PD 1..305 1..305 1578 99.7 Plus
Rip11-PA 832 CG6606-PA 1..305 1..305 1578 99.7 Plus
Rip11-PE 815 CG6606-PE 706..815 300..409 545 97.3 Plus
Rip11-PD 826 CG6606-PD 706..814 300..408 539 97.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 23:05:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15080-PA 822 GI15080-PA 1..292 1..293 1236 89.1 Plus
Dmoj\GI15080-PA 822 GI15080-PA 714..822 300..409 528 94.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 23:05:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27020-PA 890 GL27020-PA 1..339 1..302 1278 77.3 Plus
Dper\GL27020-PA 890 GL27020-PA 780..890 300..409 518 91.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 23:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19718-PA 854 GA19718-PA 1..300 1..300 1326 86.5 Plus
Dpse\GA19718-PA 854 GA19718-PA 744..852 300..407 510 91.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 23:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22796-PA 835 GM22796-PA 1..305 1..305 1420 98.7 Plus
Dsec\GM22796-PA 835 GM22796-PA 709..816 300..407 550 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 23:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15625-PA 926 GD15625-PA 65..359 11..305 1542 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 23:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18887-PA 817 GJ18887-PA 1..288 1..288 1212 88.6 Plus
Dvir\GJ18887-PA 817 GJ18887-PA 710..816 300..407 513 93.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 23:05:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24953-PA 821 GK24953-PA 1..281 1..290 1196 82.3 Plus
Dwil\GK24953-PA 821 GK24953-PA 677..785 300..407 517 92.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 23:05:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15507-PA 836 GE15507-PA 1..305 1..305 1425 98.4 Plus
Dyak\GE15507-PA 836 GE15507-PA 676..817 280..407 545 80.4 Plus

GH05001.hyp Sequence

Translation from 334 to 1563

> GH05001.hyp
MWSPTHCSVTVQRARGLLTKGKNGTNNCFVTIALGKEKYQTSVKDKAETS
VNWNEECELKIPDQGNRAELTLTCLHRNNLGIDEFLGQATLPLNEMDVYD
RPRAKWFKLESKPGKEKKNKERGELEVRIAFVVKSGSLTDLSKKDKHKSS
IGQLASSVGGSLLSIGNGEKRRGIKKLAGSLSSKLHIRSKKKNQEAGADD
SSSFGGSFASLGTPNSSNGRGQNGGSGRRRGGQRAGEADPGVISEDEDEF
VFDNLSHKSSGSSLNIQRIGLQPPPVGTPNFTPRHPSPLLNNGVSGVGSG
SAKDKYNNDNDSNSPSPKSTERIIIGHEKSGSHADRRSEISAQLAKKYEG
KSREELMLIANGMENEALLQRQRVKELEDYLDNLLLRVMETHPKILQNPY
SRTTSAKSG*

GH05001.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
Rip11-PB 409 CG6606-PB 1..409 1..409 2111 100 Plus
Rip11-PC 420 CG6606-PC 1..408 1..408 2105 100 Plus
Rip11-PE 815 CG6606-PE 1..305 1..305 1578 99.7 Plus
Rip11-PD 826 CG6606-PD 1..305 1..305 1578 99.7 Plus
Rip11-PA 832 CG6606-PA 1..305 1..305 1578 99.7 Plus
Rip11-PE 815 CG6606-PE 706..815 300..409 545 97.3 Plus
Rip11-PD 826 CG6606-PD 706..814 300..408 539 97.2 Plus