Clone GH06357 Report

Search the DGRC for GH06357

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:63
Well:57
Vector:pOT2
Associated Gene/TranscriptDlic-RA
Protein status:GH06357.pep: gold
Preliminary Size:2403
Sequenced Size:2242

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1938 2001-01-01 Release 2 assignment
CG1938 2001-09-19 Blastp of sequenced clone
CG1938 2003-01-01 Sim4 clustering to Release 3
Dlic2 2008-04-29 Release 5.5 accounting
Dlic2 2008-08-15 Release 5.9 accounting
Dlic2 2008-12-18 5.12 accounting

Clone Sequence Records

GH06357.complete Sequence

2242 bp (2242 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058302

> GH06357.complete
AGCAGTGAAGAGGAGAGGCAGTCAGATTCGACGACGCAACGGCGCTGAAA
AAACTCCAGTGGAAACGCACACGAACGCGGCTCTTCTCCACATAAATATA
CATTATATTATTTAAGTTTGCCTTGTCTAATTGAAACGATCGAAAGGCTG
TCCAGCGGAGAGGACGTGCGTGAAAATCCAGGGCGCGAGTTTTCACTGGA
GAGGAGAGCGAAGAGCGTGAGAAACTGCCACTCTCTGTTGCAGCGCCAGC
ACATCCCGTTTCCCAATTGGACCCAGCCAGGAGTGGAGAGCGTTCCAATA
GGAGCACCGCAGCTGCAGCACCAACAACAACATGGCGATGAACAGTGGGA
CGCAAACGAATGCGCTGACATCATCCTTTACCATGAAGAAAAAGGATGCG
GCCGCGGAAAAGGAGAACCTATGGTCGGCGATATTGAATGAAGTACAAAC
ACAGGGCAGCACAAAACTTCCATCAAACAAATCTGTACTAGTATTAGGCG
ACAATGCCACCGGAAAGACGACACTCATTGCCAAACTGCAGGGCGTCGAG
GATCCGAAGAAGGGTTCCGGCCTGGAGTATGCCTACATTGATGTCAAGGA
TGAGTACAGAGACGACATGACGCGTTTAGGCGTTTGGGTCCTGGACGGTG
ATCCAGGACACACAAACCTGCTACACTATGCGCTCAACGAAACGAACTAT
GCACACACACTCGTCATCCTCACCGTTTCGATGACGCAGCCGTGGGGCTG
GCTGGAGCAGCTAAACCATTGGATCAAGGTCCTCGGCCAGCACATCGATA
GCCTGCAGCTGGACGCCAAAGAGAAGGAGGCGGCCCGCCAGCGACTGACC
ACCACGTGGCAGAGCTACTGTGAGGTGGGCGACGATCTGGATCCAGGCTC
CCCCGTCAAGCGGACGATGCGCAACAACTCGATCGACGAGGATGACCTGC
TGCCGCTGACGGAGGATGCACTAATTACAAATCTGGGCCTCGACATCGTT
GTTGTGGTCACAAAGACGGACTACATGACCACGCTAGAGAAGGAGTACGA
GTATCGTGACGAGCACTTTGACTTCATCCAGCAGTGGATACGTAACTTCT
GCCTGCGGCATGGCACTTCGCTCTTCTACACGAGCGTCAAGGAAGACAAG
AACTGTGATGTCCTCTACAAGTATCTGACGCATCGAATTTATGGTCTACC
ATTCCGTACGCCAGCGCTAGTCGTTGAGAAGGATGCGGTACTCATTCCGG
CTGGCTGGGATAGCCTGAAGAAGATTAGTATTTTATACGAGAATATGCAT
GGAGTCAAGGCCGAGAATCCCTACACAGACATTATCAAATCGCCACCAAC
TAGAAAGGCGGTTTCCAATCGCGAGGCGGAAGTGCAGACGGAGGATGAGC
AGGCATTCCTGGCACGCCAGCAGGAGATCCTAAAGCAGGGCGACCAGGTG
CGCGGTGAGTCACCACTGCGATCGCAGGGCGTAGGCAGCAATAAGAGCGG
ACCCCGAACGCCCGGCACCACCGGACAGAGTTCGCCCAAAAAGATTGATC
CCAAGCTGACGCCAGCAACGCCCGGCGCCGAAGGCGTTCTAGCCAACTTC
TTTAACTCGCTGCTGCACAAAAAGTCGGGCAGTCCGGGTACCGGAGGTCC
CGGCGGAGCGGGTAATCCGGCGGGTCCGGGTCGCACTGCCAACGGTACGG
ATGCAGTAATGACGCCCGAAAAGCTGGCCGTGCGCACAGATGCGGCCGCC
GAGCTTGATCGATTATCGCGCAGTGTGAAAAAAGAGATTGACATGTCGCA
GAGTGAGTGTTGAGCCGTAGTCAACCAGGAGCAGCAACACACACACCACA
GCAGAACAGCAACAAGAGAACCACAACAACATGAGAACGTTATTTAAGCA
TCAAGTGAAGGGTAGAGACTCGTAGAGACTCGTTGAGAGTCGCAGGATAG
CTGGATAGCCGCGAAAGGGATCATCATTGGGAACAGCAGTGCTCGATCAT
TCAATGGTCCGGTAGTTGGTGTACGGGCTTTTTTATCAGTTTCGCAAGGG
GCTAGCTTCTAAGTTGTTAAGTTGTTCCACGGAACGTGATCAATGCCCAG
AGATTGTTCTTCATAACCAATTCAAAACTTTTAAGGTACTCATTTGATGG
GTTCCATAGCCACTAGTGATTCTTTTTACGAGCCTTCTGCTTTATACTCA
AACACTTTCGATAAGAAATTTAACAAAAAAAAAAAAAAAAAA

GH06357.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dlic-RA 2320 Dlic-RA 81..2316 1..2236 11180 100 Plus
Dlic.d 3817 Dlic.d 81..2316 1..2236 11180 100 Plus
Dlic.e 2865 Dlic.e 81..2316 1..2236 11180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11053770..11054452 1542..2224 3355 99.4 Plus
chrX 22417052 chrX 11052574..11052975 614..1015 1980 99.5 Plus
chrX 22417052 chrX 11053038..11053269 1014..1245 1145 99.6 Plus
chrX 22417052 chrX 11045690..11045917 1..228 1110 99.1 Plus
chrX 22417052 chrX 11046286..11046482 229..425 985 100 Plus
chrX 22417052 chrX 11052317..11052508 423..614 930 99 Plus
chrX 22417052 chrX 11053523..11053710 1356..1543 880 97.9 Plus
chrX 22417052 chrX 11053342..11053454 1246..1358 565 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dlic-RA 1482 CG1938-PA 1..1482 332..1813 7410 100 Plus
Dlic-RD 1482 CG1938-PD 1..1482 332..1813 7410 100 Plus
Dlic-RB 1197 CG1938-PB 1..1197 617..1813 5985 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:34:38 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:54:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dlic-RA 2241 CG1938-RA 18..2241 1..2224 11120 100 Plus
Dlic-RD 3715 CG1938-RD 18..2241 1..2224 11120 100 Plus
Dlic-RB 3371 CG1938-RB 97..1897 424..2224 9005 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:54:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dlic-PA 493 CG1938-PA 1..493 332..1810 2419 100 Plus
Dlic-PD 493 CG1938-PD 1..493 332..1810 2419 100 Plus
Dlic-PB 398 CG1938-PB 1..398 617..1810 1941 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11162514..11163208 1542..2236 3475 100 Plus
X 23542271 X 11161317..11161718 614..1015 2010 100 Plus
X 23542271 X 11161781..11162012 1014..1245 1160 100 Plus
X 23542271 X 11154438..11154665 1..228 1140 100 Plus
X 23542271 X 11155034..11155230 229..425 985 100 Plus
X 23542271 X 11161060..11161251 423..614 960 100 Plus
X 23542271 X 11162267..11162454 1356..1543 940 100 Plus
X 23542271 X 11162086..11162198 1246..1358 565 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:46:56
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11170612..11171306 1542..2236 3475 100 Plus
X 23527363 X 11169415..11169816 614..1015 2010 100 Plus
X 23527363 X 11169879..11170110 1014..1245 1160 100 Plus
X 23527363 X 11162536..11162763 1..228 1140 100 Plus
X 23527363 X 11163132..11163328 229..425 985 100 Plus
X 23527363 X 11169158..11169349 423..614 960 100 Plus
X 23527363 X 11170365..11170552 1356..1543 940 100 Plus
X 23527363 X 11170184..11170296 1246..1358 565 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:54:44 has no hits.

GH06357.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:07:17 Download gff for GH06357.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11053772..11054452 1544..2224 99   Plus
chrX 11053525..11053710 1358..1543 97 -> Plus
chrX 11053342..11053453 1246..1357 100 -> Plus
chrX 11053040..11053269 1016..1245 99 -> Plus
chrX 11052575..11052975 615..1015 99 -> Plus
chrX 11052318..11052508 424..614 98 -> Plus
chrX 11046295..11046480 238..423 100 -> Plus
chrX 11045690..11045921 1..237 96 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:20:34 Download gff for GH06357.complete
Subject Subject Range Query Range Percent Splice Strand
Dlic2-RC 1..1482 332..1813 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:09:30 Download gff for GH06357.complete
Subject Subject Range Query Range Percent Splice Strand
Dlic-RC 1..1482 332..1813 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:55:36 Download gff for GH06357.complete
Subject Subject Range Query Range Percent Splice Strand
Dlic-RD 1..1482 332..1813 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:40:26 Download gff for GH06357.complete
Subject Subject Range Query Range Percent Splice Strand
Dlic2-RC 1..1482 332..1813 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:07:17 Download gff for GH06357.complete
Subject Subject Range Query Range Percent Splice Strand
Dlic-RD 1..1482 332..1813 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:00:25 Download gff for GH06357.complete
Subject Subject Range Query Range Percent Splice Strand
Dlic2-RA 38..2261 1..2224 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:09:29 Download gff for GH06357.complete
Subject Subject Range Query Range Percent Splice Strand
Dlic-RA 38..2261 1..2224 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:55:36 Download gff for GH06357.complete
Subject Subject Range Query Range Percent Splice Strand
Dlic-RD 18..2241 1..2224 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:40:26 Download gff for GH06357.complete
Subject Subject Range Query Range Percent Splice Strand
Dlic2-RA 38..2261 1..2224 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:07:17 Download gff for GH06357.complete
Subject Subject Range Query Range Percent Splice Strand
Dlic-RD 18..2241 1..2224 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:07:17 Download gff for GH06357.complete
Subject Subject Range Query Range Percent Splice Strand
X 11162516..11163196 1544..2224 100   Plus
X 11162269..11162454 1358..1543 100 -> Plus
X 11162086..11162197 1246..1357 100 -> Plus
X 11161783..11162012 1016..1245 100 -> Plus
X 11161318..11161718 615..1015 100 -> Plus
X 11161061..11161251 424..614 100 -> Plus
X 11155034..11155228 229..423 100 -> Plus
X 11154438..11154665 1..228 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:55:36 Download gff for GH06357.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11056549..11057229 1544..2224 100   Plus
arm_X 11056302..11056487 1358..1543 100 -> Plus
arm_X 11056119..11056230 1246..1357 100 -> Plus
arm_X 11055816..11056045 1016..1245 100 -> Plus
arm_X 11055351..11055751 615..1015 100 -> Plus
arm_X 11055094..11055284 424..614 100 -> Plus
arm_X 11049067..11049261 229..423 100 -> Plus
arm_X 11048471..11048698 1..228 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:17:56 Download gff for GH06357.complete
Subject Subject Range Query Range Percent Splice Strand
X 11170614..11171294 1544..2224 100   Plus
X 11170367..11170552 1358..1543 100 -> Plus
X 11170184..11170295 1246..1357 100 -> Plus
X 11169881..11170110 1016..1245 100 -> Plus
X 11169416..11169816 615..1015 100 -> Plus
X 11169159..11169349 424..614 100 -> Plus
X 11163132..11163326 229..423 100 -> Plus
X 11162536..11162763 1..228 100 -> Plus

GH06357.pep Sequence

Translation from 331 to 1812

> GH06357.pep
MAMNSGTQTNALTSSFTMKKKDAAAEKENLWSAILNEVQTQGSTKLPSNK
SVLVLGDNATGKTTLIAKLQGVEDPKKGSGLEYAYIDVKDEYRDDMTRLG
VWVLDGDPGHTNLLHYALNETNYAHTLVILTVSMTQPWGWLEQLNHWIKV
LGQHIDSLQLDAKEKEAARQRLTTTWQSYCEVGDDLDPGSPVKRTMRNNS
IDEDDLLPLTEDALITNLGLDIVVVVTKTDYMTTLEKEYEYRDEHFDFIQ
QWIRNFCLRHGTSLFYTSVKEDKNCDVLYKYLTHRIYGLPFRTPALVVEK
DAVLIPAGWDSLKKISILYENMHGVKAENPYTDIIKSPPTRKAVSNREAE
VQTEDEQAFLARQQEILKQGDQVRGESPLRSQGVGSNKSGPRTPGTTGQS
SPKKIDPKLTPATPGAEGVLANFFNSLLHKKSGSPGTGGPGGAGNPAGPG
RTANGTDAVMTPEKLAVRTDAAAELDRLSRSVKKEIDMSQSEC*

GH06357.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:01:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22587-PA 572 GF22587-PA 1..490 1..491 2348 92.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:01:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18397-PA 493 GG18397-PA 1..493 1..493 2605 98.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:01:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12509-PA 504 GH12509-PA 1..504 1..493 2312 88.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dlic-PA 493 CG1938-PA 1..493 1..493 2578 100 Plus
Dlic-PD 493 CG1938-PD 1..493 1..493 2578 100 Plus
Dlic-PB 398 CG1938-PB 1..398 96..493 2100 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:01:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14862-PA 502 GI14862-PA 1..502 1..493 2239 87.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:01:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20252-PA 499 GL20252-PA 1..499 1..493 2302 90 Plus
Dper\GL22058-PA 439 GL22058-PA 4..439 24..492 1111 50.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15140-PA 499 GA15140-PA 1..499 1..493 2305 90 Plus
Dpse\GA27361-PB 451 GA27361-PB 12..451 20..492 1111 50.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11463-PA 311 GM11463-PA 1..302 1..302 1618 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19525-PA 502 GJ19525-PA 1..502 1..493 2268 89 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16106-PA 496 GK16106-PA 1..496 1..493 2316 90.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15915-PA 493 GE15915-PA 1..493 1..493 2485 98 Plus

GH06357.hyp Sequence

Translation from 331 to 1812

> GH06357.hyp
MAMNSGTQTNALTSSFTMKKKDAAAEKENLWSAILNEVQTQGSTKLPSNK
SVLVLGDNATGKTTLIAKLQGVEDPKKGSGLEYAYIDVKDEYRDDMTRLG
VWVLDGDPGHTNLLHYALNETNYAHTLVILTVSMTQPWGWLEQLNHWIKV
LGQHIDSLQLDAKEKEAARQRLTTTWQSYCEVGDDLDPGSPVKRTMRNNS
IDEDDLLPLTEDALITNLGLDIVVVVTKTDYMTTLEKEYEYRDEHFDFIQ
QWIRNFCLRHGTSLFYTSVKEDKNCDVLYKYLTHRIYGLPFRTPALVVEK
DAVLIPAGWDSLKKISILYENMHGVKAENPYTDIIKSPPTRKAVSNREAE
VQTEDEQAFLARQQEILKQGDQVRGESPLRSQGVGSNKSGPRTPGTTGQS
SPKKIDPKLTPATPGAEGVLANFFNSLLHKKSGSPGTGGPGGAGNPAGPG
RTANGTDAVMTPEKLAVRTDAAAELDRLSRSVKKEIDMSQSEC*

GH06357.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dlic-PA 493 CG1938-PA 1..493 1..493 2578 100 Plus
Dlic-PD 493 CG1938-PD 1..493 1..493 2578 100 Plus
Dlic-PB 398 CG1938-PB 1..398 96..493 2100 100 Plus